Compile Data Set for Download or QSAR
maximum 50k data
Found 147 with Last Name = 'ahn' and Initial = 'jm'
TargetBifunctional purine biosynthesis protein ATIC(Homo sapiens (Human))
University Of Tennessee

Curated by ChEMBL
LigandPNGBDBM50103596((E)-2-hydroxy-5-((4-(N-pyridin-2-ylsulfamoyl)-phen...)
Affinity DataKi:  2.20E+4nMAssay Description:Inhibition of AICAR transformylase (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDihydrofolate reductase(Homo sapiens (Human))
University Of Tennessee

Curated by ChEMBL
LigandPNGBDBM50240510(CHEMBL898 | DIFLUNISAL)
Affinity DataKi:  3.40E+4nMAssay Description:Inhibition of human DHFR in presence of DHF and NADPH by UV-vis spectrometry by Lineweaver-Burk plot analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDihydrofolate reductase(Homo sapiens (Human))
University Of Tennessee

Curated by ChEMBL
LigandPNGBDBM50219500(2-Hydroxy-5-phenylbenzoic acid | 4-Hydroxy-bipheny...)
Affinity DataKi:  4.80E+4nMAssay Description:Inhibition of human DHFR in presence of DHF and NADPH by UV-vis spectrometry by Lineweaver-Burk plot analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDihydrofolate reductase(Homo sapiens (Human))
University Of Tennessee

Curated by ChEMBL
LigandPNGBDBM50134036(2-(2,3-Dimethyl-phenylamino)-benzoic acid | 2-(2,3...)
Affinity DataKi:  7.20E+4nMAssay Description:Inhibition of human DHFR in presence of DHF and NADPH by UV-vis spectrometry by Lineweaver-Burk plot analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDihydrofolate reductase(Homo sapiens (Human))
University Of Tennessee

Curated by ChEMBL
LigandPNGBDBM50237608(CHEBI:8064 | Phenformin)
Affinity DataKi:  1.40E+5nMAssay Description:Inhibition of human DHFR in presence of DHF and NADPH by UV-vis spectrometry by Lineweaver-Burk plot analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDihydrofolate reductase(Homo sapiens (Human))
University Of Tennessee

Curated by ChEMBL
LigandPNGBDBM13066(2-{2-[(2,6-dichlorophenyl)amino]phenyl}acetic acid...)
Affinity DataKi:  1.60E+5nMAssay Description:Inhibition of human DHFR in presence of DHF and NADPH by UV-vis spectrometry by Lineweaver-Burk plot analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDihydrofolate reductase(Homo sapiens (Human))
University Of Tennessee

Curated by ChEMBL
LigandPNGBDBM50542900(CHEBI:61114 | CHEMBL3278332)
Affinity DataKi:  1.80E+5nMAssay Description:Inhibition of human DHFR in presence of DHF and NADPH by UV-vis spectrometry by Lineweaver-Burk plot analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDihydrofolate reductase(Homo sapiens (Human))
University Of Tennessee

Curated by ChEMBL
LigandPNGBDBM50542901(Diaminopyrimidine)
Affinity DataKi:  1.80E+5nMAssay Description:Inhibition of human DHFR in presence of DHF and NADPH by UV-vis spectrometry by Lineweaver-Burk plot analysisMore data for this Ligand-Target Pair
TargetDihydrofolate reductase(Homo sapiens (Human))
University Of Tennessee

Curated by ChEMBL
LigandPNGBDBM50240374(3-(4-biphenylylcarbonyl)propionic acid | 3-(4-phen...)
Affinity DataKi:  3.60E+5nMAssay Description:Inhibition of human DHFR in presence of DHF and NADPH by UV-vis spectrometry by Lineweaver-Burk plot analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDihydrofolate reductase(Homo sapiens (Human))
University Of Tennessee

Curated by ChEMBL
LigandPNGBDBM50009859((+-)-2-(p-isobutylphenyl)propionic acid | (+-)-alp...)
Affinity DataKi:  5.60E+5nMAssay Description:Inhibition of human DHFR in presence of DHF and NADPH by UV-vis spectrometry by Lineweaver-Burk plot analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDihydrofolate reductase(Homo sapiens (Human))
University Of Tennessee

Curated by ChEMBL
LigandPNGBDBM50241727((S)-2-amino-3-(1-methyl-1H-indol-3-yl)propanoic ac...)
Affinity DataKi:  8.10E+5nMAssay Description:Inhibition of human DHFR in presence of DHF and NADPH by UV-vis spectrometry by Lineweaver-Burk plot analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDihydrofolate reductase(Homo sapiens (Human))
University Of Tennessee

Curated by ChEMBL
LigandPNGBDBM50043799((2R)-2-amino-3-(1H-indol-3-yl)propanoic acid | (R)...)
Affinity DataKi:  8.80E+5nMAssay Description:Inhibition of human DHFR in presence of DHF and NADPH by UV-vis spectrometry by Lineweaver-Burk plot analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDihydrofolate reductase(Homo sapiens (Human))
University Of Tennessee

Curated by ChEMBL
LigandPNGBDBM50016799((1,8-Diethyl-1,3,4,9-tetrahydro-pyrano[3,4-b]indol...)
Affinity DataKi:  1.80E+6nMAssay Description:Inhibition of human DHFR in presence of DHF and NADPH by UV-vis spectrometry by Lineweaver-Burk plot analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDihydrofolate reductase(Homo sapiens (Human))
University Of Tennessee

Curated by ChEMBL
LigandPNGBDBM21974((2S)-2-amino-3-(1H-indol-3-yl)propanoic acid | CHE...)
Affinity DataKi:  2.80E+6nMAssay Description:Inhibition of human DHFR in presence of DHF and NADPH by UV-vis spectrometry by Lineweaver-Burk plot analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDihydrofolate reductase(Homo sapiens (Human))
University Of Tennessee

Curated by ChEMBL
LigandPNGBDBM50533571(CHEMBL1618254 | US11459295, Compound R-Naproxen (1...)
Affinity DataKi:  3.40E+6nMAssay Description:Inhibition of human DHFR in presence of DHF and NADPH by UV-vis spectrometry by Lineweaver-Burk plot analysisMore data for this Ligand-Target Pair
TargetDihydrofolate reductase(Homo sapiens (Human))
University Of Tennessee

Curated by ChEMBL
LigandPNGBDBM50339185((2S)-2-(6-methoxynaphthalen-2-yl)propanoic acid | ...)
Affinity DataKi:  7.00E+6nMAssay Description:Inhibition of human DHFR in presence of DHF and NADPH by UV-vis spectrometry by Lineweaver-Burk plot analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDihydrofolate reductase(Homo sapiens (Human))
University Of Tennessee

Curated by ChEMBL
LigandPNGBDBM50009999(CHEMBL461 | N-benzoylglycine)
Affinity DataKi:  1.70E+7nMAssay Description:Inhibition of human DHFR in presence of DHF and NADPH by UV-vis spectrometry by Lineweaver-Burk plot analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDihydrofolate reductase(Homo sapiens (Human))
University Of Tennessee

Curated by ChEMBL
LigandPNGBDBM50229665(1,1-Dimethylbiguanide | CHEMBL1431 | METFORMIN | N...)
Affinity DataKi:  1.80E+7nMAssay Description:Inhibition of human DHFR in presence of DHF and NADPH by UV-vis spectrometry by Lineweaver-Burk plot analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Rattus norvegicus)
University Of Arizona

Curated by ChEMBL
LigandPNGBDBM50104037(CHEMBL428460 | His-Ser-Gln-Gly-Lys-Phe-Thr-Ser-Glu...)
Affinity DataIC50:  0.200nMAssay Description:Glucagon receptor binding measured as 50% inhibitory concentrationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Rattus norvegicus)
University Of Arizona

Curated by ChEMBL
LigandPNGBDBM50104040(CHEMBL412488 | His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp...)
Affinity DataIC50:  0.240nMAssay Description:Glucagon receptor binding measured as 50% inhibitory concentrationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273767(CHEMBL503693)
Affinity DataIC50:  1.40nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Rattus norvegicus)
University Of Arizona

Curated by ChEMBL
LigandPNGBDBM50098571(CHEMBL266481 | GLUCAGON | His-Ser-Gln-Gly-Thr-Phe-...)
Affinity DataIC50:  1.5nMAssay Description:In vitro receptor binding affinity (95% CL) using rat liver plasma membrane bioassayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Rattus norvegicus)
University Of Arizona

Curated by ChEMBL
LigandPNGBDBM50098571(CHEMBL266481 | GLUCAGON | His-Ser-Gln-Gly-Thr-Phe-...)
Affinity DataIC50:  1.5nMAssay Description:Glucagon receptor binding measured as 50% inhibitory concentrationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Rattus norvegicus)
University Of Arizona

Curated by ChEMBL
LigandPNGBDBM50098571(CHEMBL266481 | GLUCAGON | His-Ser-Gln-Gly-Thr-Phe-...)
Affinity DataIC50:  1.5nMAssay Description:Binding affinity towards Glucagon receptor in rat liver plasma membranes by displacement of 125 I-labelled glucagonMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Rattus norvegicus)
University Of Arizona

Curated by ChEMBL
LigandPNGBDBM50098571(CHEMBL266481 | GLUCAGON | His-Ser-Gln-Gly-Thr-Phe-...)
Affinity DataIC50:  1.5nMAssay Description:inhibition of [125]glucagon specific binding.More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Rattus norvegicus)
University Of Arizona

Curated by ChEMBL
LigandPNGBDBM50104030(CHEMBL439885 | His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp...)
Affinity DataIC50:  1.70nMAssay Description:Glucagon receptor binding measured as 50% inhibitory concentrationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273752(CHEMBL503836 | HAEGTFTSDVSSYLEGQAAKEIFAWLVKGR)
Affinity DataIC50:  2.60nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273766(CHEMBL526145)
Affinity DataIC50:  2.60nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273752(CHEMBL503836 | HAEGTFTSDVSSYLEGQAAKEIFAWLVKGR)
Affinity DataIC50:  2.60nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273766(CHEMBL526145)
Affinity DataIC50:  2.60nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273765(CHEMBL525235)
Affinity DataIC50:  3.30nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273765(CHEMBL525235)
Affinity DataIC50:  3.30nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Rattus norvegicus)
University Of Arizona

Curated by ChEMBL
LigandPNGBDBM50104039(CHEMBL267189 | His-Ser-Gln-Cys-Thr-Phe-Thr-Ser-Cys...)
Affinity DataIC50:  3.60nMAssay Description:Glucagon receptor binding measured as 50% inhibitory concentrationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Rattus norvegicus)
University Of Arizona

Curated by ChEMBL
LigandPNGBDBM50098563(CHEMBL413890 | Ser-Gln-Gly-Thr-Phe-Thr-Ser-Glu-Tyr...)
Affinity DataIC50:  3.75nMAssay Description:Compound was evaluated for its ability to displace radiolabelled glucagonMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273757(CHEMBL507037)
Affinity DataIC50:  4.5nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273757(CHEMBL507037)
Affinity DataIC50:  4.5nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Rattus norvegicus)
University Of Arizona

Curated by ChEMBL
LigandPNGBDBM50104031(CHEMBL263603 | His-Cys-Gln-Gly-Thr-Phe-Cys-Ser-Asp...)
Affinity DataIC50:  5.60nMAssay Description:Glucagon receptor binding measured as 50% inhibitory concentrationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Rattus norvegicus)
University Of Arizona

Curated by ChEMBL
LigandPNGBDBM50104043(CHEMBL437648 | His-Ser-Lys-Gly-Thr-Phe-Glu-Ser-Asp...)
Affinity DataIC50:  6nMAssay Description:Glucagon receptor binding measured as 50% inhibitory concentrationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Rattus norvegicus)
University Of Arizona

Curated by ChEMBL
LigandPNGBDBM50104041(CHEMBL414077 | His-Ser-Gln-Gly-Thr-Phe-Cys-Ser-Asp...)
Affinity DataIC50:  6.40nMAssay Description:Glucagon receptor binding measured as 50% inhibitory concentrationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273758(CHEMBL526516)
Affinity DataIC50:  6.60nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273758(CHEMBL526516)
Affinity DataIC50:  6.60nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Rattus norvegicus)
University Of Arizona

Curated by ChEMBL
LigandPNGBDBM50104044(CHEMBL409654 | His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp...)
Affinity DataIC50:  14nMAssay Description:Glucagon receptor binding measured as 50% inhibitory concentrationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Rattus norvegicus)
University Of Arizona

Curated by ChEMBL
LigandPNGBDBM50104033(CHEMBL442135 | His-Ser-Gln-Gly-Thr-Phe-Lys-Ser-Asp...)
Affinity DataIC50:  14nMAssay Description:Glucagon receptor binding measured as 50% inhibitory concentrationMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273759(CHEMBL507591)
Affinity DataIC50:  15nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Rattus norvegicus)
University Of Arizona

Curated by ChEMBL
LigandPNGBDBM50098573(CHEMBL267876 | N-trinitrophenyl-His-Ser-Gln-Gly-Th...)
Affinity DataIC50:  15nMAssay Description:Compound was evaluated for its ability to displace radiolabelled glucagon (inactive up to 100 microM)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273760(CHEMBL503491)
Affinity DataIC50:  17nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon-like peptide 1 receptor(Homo sapiens (Human))
University Of Texas At Dallas

Curated by ChEMBL
LigandPNGBDBM50273760(CHEMBL503491)
Affinity DataIC50:  17nMAssay Description:Displacement of [125I]exendin(9-39) from human GLP1R expressed in HEK293 cellsMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Rattus norvegicus)
University Of Arizona

Curated by ChEMBL
LigandPNGBDBM50059352(CHEMBL442499 | [des-His1, Trp6, Glu9] glucagon-NH2)
Affinity DataIC50:  19nMAssay Description:Binding affinity towards Glucagon receptor in rat liver plasma membranes by displacement of 125 I-labelled glucagonMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Rattus norvegicus)
University Of Arizona

Curated by ChEMBL
LigandPNGBDBM50098566(CHEMBL413208 | phenylbutyryl-Tyr-Ser-Lys-Tyr-Leu-A...)
Affinity DataIC50:  21.2nMAssay Description:IC50 value of the compound was expressed as inhibition of [125]glucagon specific binding.More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlucagon receptor(Rattus norvegicus)
University Of Arizona

Curated by ChEMBL
LigandPNGBDBM50098572(Ac-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg...)
Affinity DataIC50:  31nMAssay Description:IC50 value of the compound was expressed as inhibition of [125]glucagon specific binding.More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Displayed 1 to 50 (of 147 total ) | Next | Last >>
Jump to: