Compile Data Set for Download or QSAR
maximum 50k data
Found 1830 with Last Name = 'ferre' and Initial = 'r'
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM4779(CHEMBL31965 | CHEMBL545315 | CI-1033 | Canertinib ...)
Affinity DataKi:  0.110nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReplicase polyprotein 1ab(2019-nCoV)
Pfizer

LigandPNGBDBM420298(CVD-0006356 | PF-00835231 | PF-0835231 | US1152494...)
Affinity DataKi:  0.270nMAssay Description:The respective human coronavirus Mpro in assay buffer (20 mM Tris-HCl, pH 7.3, 100 mM NaCl, 1 mM EDTA, 5 mM TCEP) and 0.1% BSA was added to assay-rea...More data for this Ligand-Target Pair
Ligand InfoPurchasePDB
In DepthDetails PDB3D3D Structure (crystal)
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361648(CHEMBL1940246)
Affinity DataKi:  0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361649(CHEMBL1938415)
Affinity DataKi:  0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361642(CHEMBL1940251)
Affinity DataKi:  0.700nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361641(CHEMBL1940247)
Affinity DataKi:  0.900nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361652(CHEMBL1940250)
Affinity DataKi:  1nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361650(CHEMBL1940248)
Affinity DataKi:  1.30nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361643(CHEMBL1940252)
Affinity DataKi:  1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361644(CHEMBL1940253)
Affinity DataKi:  1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTrifunctional purine biosynthetic protein adenosine-3(Homo sapiens (Human))
Agouron Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50059331((R)-2-({5-[2-(2-Amino-4-oxo-4,6,7,8-tetrahydro-3H-...)
Affinity DataKi:  2nMAssay Description:Inhibition of recombinant human Glycinamide Ribonucleotide Transformylase (GART) using N10-formyl-5,8-dideazafolate (FDDF) as the cofactor .More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Wuxi Apptec

Curated by ChEMBL
LigandPNGBDBM50112173(CHEMBL3608429)
Affinity DataKi:  2nMAssay Description:Inhibition of EGFR T790M/L858R double mutant (unknown origin)More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361653(CHEMBL1940245)
Affinity DataKi:  2nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Wuxi Apptec

Curated by ChEMBL
LigandPNGBDBM50450885(CHEMBL4216749)
Affinity DataKi:  2nMAssay Description:Inhibition of EGFR T790M/L858R double mutant (unknown origin)More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50159347(CHEMBL3787662 | US9586965, Cpd 1)
Affinity DataKi:  2nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50159358(CHEMBL3787386)
Affinity DataKi:  2nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Target3-phosphoinositide-dependent protein kinase 1(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50361651(CHEMBL1940249)
Affinity DataKi:  2.5nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGenome polyprotein(Human rhinovirus B)
Agouron Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50055234(1-(6-Methoxy-naphthalen-2-ylmethyl)-2,3-dioxo-2,3-...)
Affinity DataKi:  3nMAssay Description:Inhibition of human rhinovirus 3C proteaseMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Wuxi Apptec

Curated by ChEMBL
LigandPNGBDBM50450887(CHEMBL4211367)
Affinity DataKi:  3nMAssay Description:Inhibition of EGFR T790M/L858R double mutant (unknown origin)More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetTrifunctional purine biosynthetic protein adenosine-3(Homo sapiens (Human))
Agouron Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50059333((R)-2-({5-[2-(2-Amino-4-oxo-4,6,7,8-tetrahydro-3H-...)
Affinity DataKi:  3nMAssay Description:Inhibition of recombinant human Glycinamide Ribonucleotide Transformylase (GART) using N10-formyl-5,8-dideazafolate (FDDF) as the cofactor .More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50159353(CHEMBL3787220)
Affinity DataKi:  3nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50159352(CHEMBL3786802)
Affinity DataKi:  3nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50159349(CHEMBL3786962)
Affinity DataKi:  3nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Wuxi Apptec

Curated by ChEMBL
LigandPNGBDBM50450884(CHEMBL4211782)
Affinity DataKi:  3nMAssay Description:Inhibition of EGFR T790M/L858R double mutant (unknown origin)More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetReplicase polyprotein 1ab(2019-nCoV)
Pfizer

LigandPNGBDBM496902(CVD-0018409 | PF-07321332 | US11351149, Example 13...)
Affinity DataKi:  3.11nMAssay Description:The respective human coronavirus Mpro in assay buffer (20 mM Tris-HCl, pH 7.3, 100 mM NaCl, 1 mM EDTA, 5 mM TCEP) and 0.1% BSA was added to assay-rea...More data for this Ligand-Target Pair
In DepthDetails PDB3D3D Structure (crystal)
TargetTrifunctional purine biosynthetic protein adenosine-3(Homo sapiens (Human))
Agouron Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50059332(2-{3-[2-(2-Amino-4-oxo-4,6,7,8-tetrahydro-3H-pyrim...)
Affinity DataKi:  3.40nMAssay Description:Inhibition of recombinant human Glycinamide Ribonucleotide Transformylase (GART) using N10-formyl-5,8-dideazafolate (FDDF) as the cofactor .More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAmine oxidase [flavin-containing] A(Rattus norvegicus (rat))
Sapienza University Of Rome

Curated by ChEMBL
LigandPNGBDBM50168981(1-(1-Methyl-1H-pyrrol-2-yl)-2-phenyl-2-pyrrolidin-...)
Affinity DataKi:  3.5nMAssay Description:Inhibtory concentration for rat Monoamine oxidase AMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGenome polyprotein(Human rhinovirus B)
Agouron Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50055213(1-(3,5-Dihydroxy-benzyl)-2,3-dioxo-2,3-dihydro-1H-...)
Affinity DataKi:  4nMAssay Description:Inhibition of human rhinovirus 3C proteaseMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50159360(CHEMBL3786098)
Affinity DataKi:  4nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGenome polyprotein(Human rhinovirus B)
Agouron Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50055218(1-(2-naphthlmethyl) isatin-5-carboxamide | 1-Napht...)
Affinity DataKi:  4nMAssay Description:Inhibition of human rhinovirus 3C proteaseMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Wuxi Apptec

Curated by ChEMBL
LigandPNGBDBM50450886(CHEMBL4206481)
Affinity DataKi:  4nMAssay Description:Inhibition of EGFR T790M/L858R double mutant (unknown origin)More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50159356(CHEMBL3786523)
Affinity DataKi:  4nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGenome polyprotein(Human rhinovirus B)
Agouron Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50055232(1-(6-Hydroxy-naphthalen-2-ylmethyl)-2,3-dioxo-2,3-...)
Affinity DataKi:  4nMAssay Description:Inhibition of human rhinovirus 3C proteaseMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGenome polyprotein(Human rhinovirus B)
Agouron Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50065598(CHEMBL419332 | {(S)-1-[(S)-1-((S)-3-Dimethylcarbam...)
Affinity DataKi:  5nMAssay Description:Binding affinity against HRV-14 3C protease.More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGenome polyprotein(Human rhinovirus B)
Agouron Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50065588(CHEMBL96803 | [(S)-1-((S)-1-{(S)-1-Formyl-2-[(isox...)
Affinity DataKi:  5nMAssay Description:Binding affinity against HRV-14 3C protease.More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGenome polyprotein(Human rhinovirus B)
Agouron Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50065603(CHEMBL96185 | {(S)-1-[(S)-1-((S)-1-Formyl-3-methan...)
Affinity DataKi:  5nMAssay Description:Binding affinity against HRV-14 3C protease.More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM34012(3-fluorophenylalanine derivative, 21b)
Affinity DataKi:  6nM ΔG°:  -45.4kJ/molepH: 7.5 T: 2°CAssay Description:The cis/trans conversion of cis-Suc-AEPFpNA peptide by the PPIase led to the cleavage of para nitroaniline by subtilisin which was monitored at 390 n...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGenome polyprotein(Human rhinovirus B)
Agouron Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50055217(1-(3,4-Dimethyl-benzyl)-2,3-dioxo-2,3-dihydro-1H-i...)
Affinity DataKi:  6nMAssay Description:Inhibition of human rhinovirus 3C proteaseMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM50314714((R)-N-(1-(3-fluorophenyl)-3-hydroxypropan-2-yl)ben...)
Affinity DataKi:  6nMAssay Description:Displacement of WFYpSPFLE from human Pin1 catalytic domain after 10-20 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Wuxi Apptec

Curated by ChEMBL
LigandPNGBDBM50450871(CHEMBL4205392)
Affinity DataKi:  6nMAssay Description:Inhibition of EGFR T790M/L858R double mutant (unknown origin)More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetGenome polyprotein(Human rhinovirus B)
Agouron Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50065590(((S)-1-{(S)-1-[(S)-1-(Acetylamino-methyl)-2-oxo-et...)
Affinity DataKi:  6nMAssay Description:Binding affinity against HRV-14 3C protease.More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAmine oxidase [flavin-containing] A(Rattus norvegicus (rat))
Sapienza University Of Rome

Curated by ChEMBL
LigandPNGBDBM50168986(1-(1-Methyl-1H-pyrrol-2-yl)-2-piperidin-1-yl-ethan...)
Affinity DataKi:  7nMAssay Description:Inhibtory concentration for rat Monoamine oxidase AMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGenome polyprotein(Human rhinovirus B)
Agouron Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50065586(((S)-3-Methyl-1-{(S)-1-[(S)-2-oxo-1-(propionylamin...)
Affinity DataKi:  7nMAssay Description:Binding affinity against HRV-14 3C protease.More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetAmine oxidase [flavin-containing] A(Rattus norvegicus (rat))
Sapienza University Of Rome

Curated by ChEMBL
LigandPNGBDBM50168987(1-(1-Methyl-1H-pyrrol-2-yl)-2-phenyl-2-pyrrolidin-...)
Affinity DataKi:  7.5nMAssay Description:Inhibtory concentration for rat Monoamine oxidase AMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReplicase polyprotein 1ab(2019-nCoV)
Pfizer

LigandPNGBDBM496900(science.abl4784, 4)
Affinity DataKi:  7.93nMAssay Description:The respective human coronavirus Mpro in assay buffer (20 mM Tris-HCl, pH 7.3, 100 mM NaCl, 1 mM EDTA, 5 mM TCEP) and 0.1% BSA was added to assay-rea...More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Wuxi Apptec

Curated by ChEMBL
LigandPNGBDBM50450868(CHEMBL4216679)
Affinity DataKi:  8nMAssay Description:Inhibition of EGFR T790M/L858R double mutant (unknown origin)More data for this Ligand-Target Pair
Ligand InfoPC cidPC sid
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50159354(CHEMBL3786220)
Affinity DataKi:  8nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
LigandPNGBDBM34011(3-fluorophenylalanine derivative, 21a)
Affinity DataKi:  8nM ΔG°:  -44.7kJ/molepH: 7.5 T: 2°CAssay Description:The cis/trans conversion of cis-Suc-AEPFpNA peptide by the PPIase led to the cleavage of para nitroaniline by subtilisin which was monitored at 390 n...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEpidermal growth factor receptor(Homo sapiens (Human))
Pfizer

Curated by ChEMBL
LigandPNGBDBM50159351(CHEMBL3786858)
Affinity DataKi:  8nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTrifunctional purine biosynthetic protein adenosine-3(Homo sapiens (Human))
Agouron Pharmaceuticals

Curated by ChEMBL
LigandPNGBDBM50059342((S)-2-({5-[3-(2,4-Diamino-6-oxo-1,6-dihydro-pyrimi...)
Affinity DataKi:  8.5nMAssay Description:Inhibition of recombinant human Glycinamide Ribonucleotide Transformylase (GART) using N10-formyl-5,8-dideazafolate (FDDF) as the cofactor .More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Displayed 1 to 50 (of 1830 total ) | Next | Last >>
Jump to: