Affinity DataKi: 0.110nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
Affinity DataKi: 0.270nMAssay Description:The respective human coronavirus Mpro in assay buffer (20 mM Tris-HCl, pH 7.3, 100 mM NaCl, 1 mM EDTA, 5 mM TCEP) and 0.1% BSA was added to assay-rea...More data for this Ligand-Target Pair
Affinity DataKi: 0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 0.700nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataKi: 0.900nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 1nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 1.30nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataKi: 1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
TargetTrifunctional purine biosynthetic protein adenosine-3(Homo sapiens (Human))
Agouron Pharmaceuticals
Curated by ChEMBL
Agouron Pharmaceuticals
Curated by ChEMBL
Affinity DataKi: 2nMAssay Description:Inhibition of recombinant human Glycinamide Ribonucleotide Transformylase (GART) using N10-formyl-5,8-dideazafolate (FDDF) as the cofactor .More data for this Ligand-Target Pair
Affinity DataKi: 2nMAssay Description:Inhibition of EGFR T790M/L858R double mutant (unknown origin)More data for this Ligand-Target Pair
Affinity DataKi: 2nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 2nMAssay Description:Inhibition of EGFR T790M/L858R double mutant (unknown origin)More data for this Ligand-Target Pair
Affinity DataKi: 2nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
Affinity DataKi: 2nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
Affinity DataKi: 2.5nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 3nMAssay Description:Inhibition of human rhinovirus 3C proteaseMore data for this Ligand-Target Pair
Affinity DataKi: 3nMAssay Description:Inhibition of EGFR T790M/L858R double mutant (unknown origin)More data for this Ligand-Target Pair
TargetTrifunctional purine biosynthetic protein adenosine-3(Homo sapiens (Human))
Agouron Pharmaceuticals
Curated by ChEMBL
Agouron Pharmaceuticals
Curated by ChEMBL
Affinity DataKi: 3nMAssay Description:Inhibition of recombinant human Glycinamide Ribonucleotide Transformylase (GART) using N10-formyl-5,8-dideazafolate (FDDF) as the cofactor .More data for this Ligand-Target Pair
Affinity DataKi: 3nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
Affinity DataKi: 3nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
Affinity DataKi: 3nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
Affinity DataKi: 3nMAssay Description:Inhibition of EGFR T790M/L858R double mutant (unknown origin)More data for this Ligand-Target Pair
Affinity DataKi: 3.11nMAssay Description:The respective human coronavirus Mpro in assay buffer (20 mM Tris-HCl, pH 7.3, 100 mM NaCl, 1 mM EDTA, 5 mM TCEP) and 0.1% BSA was added to assay-rea...More data for this Ligand-Target Pair
TargetTrifunctional purine biosynthetic protein adenosine-3(Homo sapiens (Human))
Agouron Pharmaceuticals
Curated by ChEMBL
Agouron Pharmaceuticals
Curated by ChEMBL
Affinity DataKi: 3.40nMAssay Description:Inhibition of recombinant human Glycinamide Ribonucleotide Transformylase (GART) using N10-formyl-5,8-dideazafolate (FDDF) as the cofactor .More data for this Ligand-Target Pair
TargetAmine oxidase [flavin-containing] A(Rattus norvegicus (rat))
Sapienza University Of Rome
Curated by ChEMBL
Sapienza University Of Rome
Curated by ChEMBL
Affinity DataKi: 3.5nMAssay Description:Inhibtory concentration for rat Monoamine oxidase AMore data for this Ligand-Target Pair
Affinity DataKi: 4nMAssay Description:Inhibition of human rhinovirus 3C proteaseMore data for this Ligand-Target Pair
Affinity DataKi: 4nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
Affinity DataKi: 4nMAssay Description:Inhibition of human rhinovirus 3C proteaseMore data for this Ligand-Target Pair
Affinity DataKi: 4nMAssay Description:Inhibition of EGFR T790M/L858R double mutant (unknown origin)More data for this Ligand-Target Pair
Affinity DataKi: 4nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
Affinity DataKi: 4nMAssay Description:Inhibition of human rhinovirus 3C proteaseMore data for this Ligand-Target Pair
Affinity DataKi: 5nMAssay Description:Binding affinity against HRV-14 3C protease.More data for this Ligand-Target Pair
Affinity DataKi: 5nMAssay Description:Binding affinity against HRV-14 3C protease.More data for this Ligand-Target Pair
Affinity DataKi: 5nMAssay Description:Binding affinity against HRV-14 3C protease.More data for this Ligand-Target Pair
Affinity DataKi: 6nM ΔG°: -45.4kJ/molepH: 7.5 T: 2°CAssay Description:The cis/trans conversion of cis-Suc-AEPFpNA peptide by the PPIase led to the cleavage of para nitroaniline by subtilisin which was monitored at 390 n...More data for this Ligand-Target Pair
Affinity DataKi: 6nMAssay Description:Inhibition of human rhinovirus 3C proteaseMore data for this Ligand-Target Pair
Affinity DataKi: 6nMAssay Description:Displacement of WFYpSPFLE from human Pin1 catalytic domain after 10-20 mins by fluorescence polarization assayMore data for this Ligand-Target Pair
Affinity DataKi: 6nMAssay Description:Inhibition of EGFR T790M/L858R double mutant (unknown origin)More data for this Ligand-Target Pair
Affinity DataKi: 6nMAssay Description:Binding affinity against HRV-14 3C protease.More data for this Ligand-Target Pair
TargetAmine oxidase [flavin-containing] A(Rattus norvegicus (rat))
Sapienza University Of Rome
Curated by ChEMBL
Sapienza University Of Rome
Curated by ChEMBL
Affinity DataKi: 7nMAssay Description:Inhibtory concentration for rat Monoamine oxidase AMore data for this Ligand-Target Pair
Affinity DataKi: 7nMAssay Description:Binding affinity against HRV-14 3C protease.More data for this Ligand-Target Pair
TargetAmine oxidase [flavin-containing] A(Rattus norvegicus (rat))
Sapienza University Of Rome
Curated by ChEMBL
Sapienza University Of Rome
Curated by ChEMBL
Affinity DataKi: 7.5nMAssay Description:Inhibtory concentration for rat Monoamine oxidase AMore data for this Ligand-Target Pair
Affinity DataKi: 7.93nMAssay Description:The respective human coronavirus Mpro in assay buffer (20 mM Tris-HCl, pH 7.3, 100 mM NaCl, 1 mM EDTA, 5 mM TCEP) and 0.1% BSA was added to assay-rea...More data for this Ligand-Target Pair
Affinity DataKi: 8nMAssay Description:Inhibition of EGFR T790M/L858R double mutant (unknown origin)More data for this Ligand-Target Pair
Affinity DataKi: 8nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
Affinity DataKi: 8nM ΔG°: -44.7kJ/molepH: 7.5 T: 2°CAssay Description:The cis/trans conversion of cis-Suc-AEPFpNA peptide by the PPIase led to the cleavage of para nitroaniline by subtilisin which was monitored at 390 n...More data for this Ligand-Target Pair
Affinity DataKi: 8nMAssay Description:Reversible binding affinity to human EGFR L858R/ T790M double mutant expressed in baculovirus by fluorometric analysisMore data for this Ligand-Target Pair
TargetTrifunctional purine biosynthetic protein adenosine-3(Homo sapiens (Human))
Agouron Pharmaceuticals
Curated by ChEMBL
Agouron Pharmaceuticals
Curated by ChEMBL
Affinity DataKi: 8.5nMAssay Description:Inhibition of recombinant human Glycinamide Ribonucleotide Transformylase (GART) using N10-formyl-5,8-dideazafolate (FDDF) as the cofactor .More data for this Ligand-Target Pair