Affinity DataKi: 0.330nMAssay Description:Displacement of [3H]8-arginine-vasopressin from human oxytocin receptor expressed in CHO cell membrane incubated for 1 hr by liquid scintillation cou...More data for this Ligand-Target Pair
Affinity DataKi: 0.440nMAssay Description:Displacement of [3H]8-arginine-vasopressin from human oxytocin receptor expressed in CHO cell membrane incubated for 1 hr by liquid scintillation cou...More data for this Ligand-Target Pair
Affinity DataKi: 0.5nMAssay Description:Binding affinity at human recombinant adrenergic alpha2C receptor expressed in CHO cells by radioligand binding assayMore data for this Ligand-Target Pair
Affinity DataKi: 0.600nMAssay Description:Binding affinity at human recombinant adrenergic alpha2C receptor expressed in CHO cells by radioligand binding assayMore data for this Ligand-Target Pair
Affinity DataKi: 0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 0.600nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 0.700nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataKi: 0.800nMAssay Description:Binding affinity at human recombinant adrenergic alpha2C receptor expressed in CHO cells by radioligand binding assayMore data for this Ligand-Target Pair
Affinity DataKi: 0.800nMAssay Description:Binding affinity at human recombinant adrenergic alpha2C receptor expressed in CHO cells by radioligand binding assayMore data for this Ligand-Target Pair
Affinity DataKi: 0.900nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 0.900nMAssay Description:Binding affinity at human recombinant adrenergic alpha2C receptor expressed in CHO cells by radioligand binding assayMore data for this Ligand-Target Pair
Affinity DataKi: 0.970nMAssay Description:Displacement of [3H]8-arginine-vasopressin from human oxytocin receptor expressed in CHO cell membrane incubated for 1 hr by liquid scintillation cou...More data for this Ligand-Target Pair
Affinity DataKi: 1nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 1.10nMAssay Description:Displacement of [3H]8-arginine-vasopressin from human oxytocin receptor expressed in CHO cell membrane incubated for 1 hr by liquid scintillation cou...More data for this Ligand-Target Pair
Affinity DataKi: 1.30nMAssay Description:Displacement of [3H]8-arginine-vasopressin from human oxytocin receptor expressed in CHO cell membrane incubated for 1 hr by liquid scintillation cou...More data for this Ligand-Target Pair
Affinity DataKi: 1.30nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataKi: 1.40nMAssay Description:Inhibition of recombinant human His-tagged PDK1 catalytic domain using Ac-Sox-PKTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIAD-NH2 as substrate by fluorescence...More data for this Ligand-Target Pair
Affinity DataKi: 1.70nMAssay Description:Antagonist activity at human recombinant adrenergic Alpha-2C receptor expressed in CHO cells assessed as inhibition of NE-induced calcium mobilizatio...More data for this Ligand-Target Pair
Affinity DataKi: 1.90nMAssay Description:Binding affinity at human recombinant adrenergic alpha2C receptor expressed in CHO cells by radioligand binding assayMore data for this Ligand-Target Pair
Affinity DataKi: 1.90nMAssay Description:Antagonist activity at human recombinant adrenergic Alpha-2C receptor expressed in CHO cells assessed as inhibition of NE-induced calcium mobilizatio...More data for this Ligand-Target Pair
Affinity DataKi: 1.90nMAssay Description:Antagonist activity at human recombinant adrenergic Alpha-2C receptor expressed in CHO cells assessed as inhibition of NE-induced calcium mobilizatio...More data for this Ligand-Target Pair
Affinity DataKi: 2nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 2.5nMAssay Description:Inhibition of PDK1-mediated AKT1 phosphorylation at T308 in human H460 cells after 2 hrs by ELISAMore data for this Ligand-Target Pair
Affinity DataKi: 2.5nMAssay Description:Binding affinity at human recombinant adrenergic alpha2C receptor expressed in CHO cells by radioligand binding assayMore data for this Ligand-Target Pair
Affinity DataKi: 3nMAssay Description:Binding affinity at human recombinant adrenergic alpha2C receptor expressed in CHO cells by radioligand binding assayMore data for this Ligand-Target Pair
Affinity DataKi: 3.70nMAssay Description:Displacement of [3H]8-arginine-vasopressin from human oxytocin receptor expressed in CHO cell membrane incubated for 1 hr by liquid scintillation cou...More data for this Ligand-Target Pair
Affinity DataKi: 3.80nMAssay Description:Antagonist activity at human recombinant adrenergic Alpha-2C receptor expressed in CHO cells assessed as inhibition of NE-induced calcium mobilizatio...More data for this Ligand-Target Pair
Affinity DataKi: 4.80nMAssay Description:Antagonist activity at human recombinant adrenergic Alpha-2C receptor expressed in CHO cells assessed as inhibition of NE-induced calcium mobilizatio...More data for this Ligand-Target Pair
Affinity DataKi: 5nMAssay Description:Binding affinity at human recombinant adrenergic alpha2C receptor expressed in CHO cells by radioligand binding assayMore data for this Ligand-Target Pair
Affinity DataKi: 5.20nMAssay Description:Antagonist activity at human recombinant adrenergic alpha2B receptor expressed in CHO cells assessed as inhibition of NE-induced calcium mobilization...More data for this Ligand-Target Pair
Affinity DataKi: 5.5nMAssay Description:Displacement of [3H]8-arginine-vasopressin from human oxytocin receptor expressed in CHO cell membrane incubated for 1 hr by liquid scintillation cou...More data for this Ligand-Target Pair
Affinity DataKi: 6.80nMAssay Description:Antagonist activity at human recombinant adrenergic Alpha-2C receptor expressed in CHO cells assessed as inhibition of NE-induced calcium mobilizatio...More data for this Ligand-Target Pair
Affinity DataKi: 6.80nMAssay Description:Displacement of [3H]8-arginine-vasopressin from human oxytocin receptor expressed in CHO cell membrane incubated for 1 hr by liquid scintillation cou...More data for this Ligand-Target Pair
Affinity DataKi: 8nMAssay Description:Binding affinity at human recombinant adrenergic alpha2B receptor expressed in CHO cells by radioligand binding assayMore data for this Ligand-Target Pair
Affinity DataKi: 9.20nMAssay Description:Binding affinity at human recombinant adrenergic alpha2C receptor expressed in CHO cells by radioligand binding assayMore data for this Ligand-Target Pair
Affinity DataKi: 10nMAssay Description:Inhibition of His-tagged AKT1 using 5FAM-GRPRTSSFAEGCONH2 as substrate by fluorescence based assayMore data for this Ligand-Target Pair
Affinity DataKi: 11nMAssay Description:Binding affinity at human recombinant adrenergic alpha2B receptor expressed in CHO cells by radioligand binding assayMore data for this Ligand-Target Pair
Affinity DataKi: 11nMAssay Description:Binding affinity at human recombinant adrenergic alpha2B receptor expressed in CHO cells by radioligand binding assayMore data for this Ligand-Target Pair
Affinity DataKi: 11nMAssay Description:Displacement of [3H]8-arginine-vasopressin from human oxytocin receptor expressed in CHO cell membrane incubated for 1 hr by liquid scintillation cou...More data for this Ligand-Target Pair
Affinity DataKi: 13nMAssay Description:Antagonist activity at human recombinant adrenergic alpha2B receptor expressed in CHO cells assessed as inhibition of NE-induced calcium mobilization...More data for this Ligand-Target Pair
Affinity DataKi: 14nMAssay Description:Binding affinity at human recombinant adrenergic alpha2B receptor expressed in CHO cells by radioligand binding assayMore data for this Ligand-Target Pair
Affinity DataKi: 14nMAssay Description:Antagonist activity at human recombinant adrenergic alpha2B receptor expressed in CHO cells assessed as inhibition of NE-induced calcium mobilization...More data for this Ligand-Target Pair
Affinity DataKi: 15nMAssay Description:Antagonist activity at human recombinant adrenergic alpha2A receptor expressed in CHO cells assessed as inhibition of NE-induced calcium mobilization...More data for this Ligand-Target Pair
Affinity DataKi: 15nMAssay Description:Binding affinity at human recombinant adrenergic alpha2B receptor expressed in CHO cells by radioligand binding assayMore data for this Ligand-Target Pair
Affinity DataKi: 16nMAssay Description:Binding affinity at human recombinant adrenergic alpha2C receptor expressed in CHO cells by radioligand binding assayMore data for this Ligand-Target Pair
Affinity DataKi: 17nMAssay Description:Antagonist activity at human recombinant adrenergic alpha2B receptor expressed in CHO cells assessed as inhibition of NE-induced calcium mobilization...More data for this Ligand-Target Pair
Affinity DataKi: 18nMAssay Description:Binding affinity at human recombinant adrenergic alpha2B receptor expressed in CHO cells by radioligand binding assayMore data for this Ligand-Target Pair
Affinity DataKi: 20nMAssay Description:Binding affinity at human recombinant adrenergic alpha2C receptor expressed in CHO cells by radioligand binding assayMore data for this Ligand-Target Pair
Affinity DataKi: 21nMAssay Description:Antagonist activity at human recombinant adrenergic Alpha-2C receptor expressed in CHO cells assessed as inhibition of NE-induced calcium mobilizatio...More data for this Ligand-Target Pair