Compile Data Set for Download or QSAR
maximum 50k data
Found 342 with Last Name = 'venkata subbaiah' and Initial = 'dr'
TargetSerine/threonine-protein kinase PLK2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50:  310nMAssay Description:Inhibition of human recombinant PLK2 using recombinant dephosphorylated bovine alpha- casein as substrate after 30 mins by scintillation counting ana...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135424(CHEMBL3747595)
Affinity DataIC50:  350nMAssay Description:Inhibition of human recombinant PLK2 using recombinant dephosphorylated bovine alpha- casein as substrate after 30 mins by scintillation counting ana...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50:  374nMAssay Description:Inhibition of human PLK2 using casein as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135411(CHEMBL3746075)
Affinity DataIC50:  470nMAssay Description:Inhibition of human recombinant PLK2 using recombinant dephosphorylated bovine alpha- casein as substrate after 30 mins by scintillation counting ana...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50:  630nMAssay Description:Inhibition of human NEK1 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135410(CHEMBL3747002)
Affinity DataIC50:  1.07E+3nMAssay Description:Inhibition of human recombinant PLK2 using recombinant dephosphorylated bovine alpha- casein as substrate after 30 mins by scintillation counting ana...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135287(CHEMBL3746910)
Affinity DataIC50:  1.23E+3nMAssay Description:Inhibition of human recombinant PLK2 using recombinant dephosphorylated bovine alpha- casein as substrate after 30 mins by scintillation counting ana...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50:  1.83E+3nMAssay Description:Inhibition of human NEK2 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek5(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50:  4.42E+3nMAssay Description:Inhibition of human NEK5 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetEphrin type-A receptor 6(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >5.00E+3nMAssay Description:Inhibition of human EPHA6 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >5.00E+3nMAssay Description:Inhibition of human FGFR1 using [KKKSPGEYVNIEFG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetFibroblast growth factor receptor 3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >5.00E+3nMAssay Description:Inhibition of human FGFR3 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase Nek9(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >5.00E+3nMAssay Description:Inhibition of human NEK9 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >5.00E+3nMAssay Description:Inhibition of human FLT3 using [EAIYAAPFAKKK] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetGlycogen synthase kinase-3 alpha(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >5.00E+3nMAssay Description:Inhibition of human GSK3alpha using [YRRAAVPPSPSLSRHSSPHQ(pS)EDEEE] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTestis-specific serine/threonine-protein kinase 3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >5.00E+3nMAssay Description:Inhibition of human TSSK3 using [KKKVSRSGLYRSPSMPENLNRPR] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetRibosomal protein S6 kinase alpha-1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >5.00E+3nMAssay Description:Inhibition of human RSK1 using [KKLNRTLSVA] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetTRAF2 and NCK-interacting protein kinase(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >5.00E+3nMAssay Description:Inhibition of human TNIK using [RLGRDKYKTLRQIRQ] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetHigh affinity nerve growth factor receptor(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >5.00E+3nMAssay Description:Inhibition of human TRKA using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase PLK2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135290(CHEMBL3745753)
Affinity DataIC50:  6.08E+3nMAssay Description:Inhibition of human recombinant PLK2 using recombinant dephosphorylated bovine alpha- casein as substrate after 30 mins by scintillation counting ana...More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type II subunit gamma(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CAMK2gamma using [KKLNRTLSFAEPG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase type IV(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CAMK4 using [KKLNRTLSFAEPG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase kinase 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CAMKK1 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCalcium/calmodulin-dependent protein kinase kinase 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CAMKK2 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCell division cycle 7-related protein kinase/Protein DBF4 homolog A(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDC7/DBF4 using [KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDK1/cyclin B using histone H1 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase/G1/S-specific cyclin- 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDK1/cyclin E using RP protein as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDK2/cyclin A using histone H1 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 2/G1/S-specific cyclin-E1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDK2/cyclin E using histone H1 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 3/G1/S-specific cyclin-E1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDK3/cyclin E using histone H1 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDK4/cyclin D1 using RB-CTF as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDK4/cyclin D3 using RB-CTF as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP kinase-activated protein kinase 3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MAPKAPK3 using [KKLNRTLSVA] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP kinase-activated protein kinase 5(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MAPKAPK5 using [KKLNRTLSVA] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase MARK1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MARK1 using [KKKVSRSGLYRSPSMPENLNRPR] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetSerine/threonine-protein kinase MARK2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MARK2 using [KKKVSRSGLYRSPSMPENLNRPR] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP/microtubule affinity-regulating kinase 3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MARK3 using [KKKVSRSGLYRSPSMPENLNRPR] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMAP/microtubule affinity-regulating kinase 4(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MARK4 using [KKKVSRSGLYRSPSMPENLNRPR] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MEK1 using ERK2 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MEK2 using ERK2 as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MEK3 using p38alpha as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MEKK1 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MEKK2 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMitogen-activated protein kinase kinase kinase 3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MEKK3 using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMaternal embryonic leucine zipper kinase(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MELK using [KKLNRTLSFAEPG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMisshapen-like kinase 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MINK using MBP as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 4(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MKK4More data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetDual specificity mitogen-activated protein kinase kinase 6(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MKK6 using p38alpha as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
TargetMyosin light chain kinase, smooth muscle(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai

Curated by ChEMBL
LigandPNGBDBM50135286(CHEMBL3745885)
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MLCK using [KKLNRTLSFAEPG] as substrateMore data for this Ligand-Target Pair
In DepthDetails ArticlePubMed
Displayed 1 to 50 (of 342 total ) | Next | Last >>
Jump to: