TargetCyclin-dependent kinase 5(Homo sapiens (Human))
Tianjin University Of Science And Technology
Curated by ChEMBL
Tianjin University Of Science And Technology
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK5 (unknown origin)More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 5 activator 1(Homo sapiens (Human))
The People'S Hospital Of Xinjiang Uyghur Autonomous Region
Curated by ChEMBL
The People'S Hospital Of Xinjiang Uyghur Autonomous Region
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK5/p35 (unknown origin)More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 5(Homo sapiens (Human))
Tianjin University Of Science And Technology
Curated by ChEMBL
Tianjin University Of Science And Technology
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of Cdk5 (unknown origin)More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 2(Homo sapiens (Human))
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 1(Homo sapiens (Human))
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK1 (unknown origin)More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 4(Homo sapiens (Human))
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK4 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK9 (unknown origin) expressed in Sf9 insect cells using biotinylated peptide derived Histone H1 as substrate incubated for 1 hr in pr...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 5(Homo sapiens (Human))
Tianjin University Of Science And Technology
Curated by ChEMBL
Tianjin University Of Science And Technology
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK5 (unknown origin) expressed in Sf9 insect cells using biotinylated peptide derived Histone H1 as substrate incubated for 1 hr in pr...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 4(Homo sapiens (Human))
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK4 (unknown origin) expressed in Sf9 insect cells incubated for 1 hr in presence of [gamma33P]ATP by liquid scintillation counter met...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 2(Homo sapiens (Human))
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2 (unknown origin) expressed in Sf9 insect cells using biotinylated peptide derived Histone H1 as substrate incubated for 1 hr in pr...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 1(Homo sapiens (Human))
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK1 (unknown origin) expressed in Sf9 insect cells using biotinylated peptide derived Histone H1 as substrate incubated for 1 hr in pr...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 2(Homo sapiens (Human))
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of human CDK2More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 5(Homo sapiens (Human))
Tianjin University Of Science And Technology
Curated by ChEMBL
Tianjin University Of Science And Technology
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK5 (unknown origin)More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 2(Homo sapiens (Human))
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 5(Homo sapiens (Human))
Tianjin University Of Science And Technology
Curated by ChEMBL
Tianjin University Of Science And Technology
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK5 (unknown origin) expressed in baculovirus infected Sf9 cells using biotinylated Histone H1 peptide as substrate incuba...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 2(Homo sapiens (Human))
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK2 (unknown origin) expressed in baculovirus infected Sf9 cells using biotinylated Histone H1 peptide as substrate incuba...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 2(Homo sapiens (Human))
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 5(Homo sapiens (Human))
Tianjin University Of Science And Technology
Curated by ChEMBL
Tianjin University Of Science And Technology
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK5 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated peptide as substrate after 1 hr...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 2(Homo sapiens (Human))
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK2 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated peptide as substrate after 1 hr...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 2(Homo sapiens (Human))
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK2 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated-histone H1 as substrate incubat...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 5(Homo sapiens (Human))
Tianjin University Of Science And Technology
Curated by ChEMBL
Tianjin University Of Science And Technology
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK5 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated-histone H1 as substrate incubat...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 5(Homo sapiens (Human))
Tianjin University Of Science And Technology
Curated by ChEMBL
Tianjin University Of Science And Technology
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK5 (unknown origin) expressed in baculovirus infected Sf9 insect cells using histone H1 as substrate after 1 hr by liquid scintillati...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 2(Homo sapiens (Human))
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2 (unknown origin) expressed in baculovirus infected Sf9 insect cells using histone H1 as substrate after 1 hr by liquid scintillati...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 2(Homo sapiens (Human))
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 5(Homo sapiens (Human))
Tianjin University Of Science And Technology
Curated by ChEMBL
Tianjin University Of Science And Technology
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of CDK5 (unknown origin)More data for this Ligand-Target Pair
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nebraska Medical Center
Curated by ChEMBL
University Of Nebraska Medical Center
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK2/cyclin A (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated histone H1 as substrat...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 5 activator 1(Homo sapiens (Human))
The People'S Hospital Of Xinjiang Uyghur Autonomous Region
Curated by ChEMBL
The People'S Hospital Of Xinjiang Uyghur Autonomous Region
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK5/p25 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated histone H1 as substrate aft...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 2(Homo sapiens (Human))
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK2 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated Histone H1 as substrate after 1...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 5(Homo sapiens (Human))
Tianjin University Of Science And Technology
Curated by ChEMBL
Tianjin University Of Science And Technology
Curated by ChEMBL
Affinity DataIC50: 1nMAssay Description:Inhibition of recombinant CDK5 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated Histone H1 as substrate after 1...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 5 activator 1(Homo sapiens (Human))
The People'S Hospital Of Xinjiang Uyghur Autonomous Region
Curated by ChEMBL
The People'S Hospital Of Xinjiang Uyghur Autonomous Region
Curated by ChEMBL
Affinity DataIC50: 1.60nMAssay Description:Inhibition of full length N-terminal GST fused human CDK5(1 to 292 residues)/ p25 (99 to 307 residues) expressed in baculovirus expression system usi...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 2/G1/S-specific cyclin-E1(Homo sapiens (Human))
Palack£
Curated by ChEMBL
Palack£
Curated by ChEMBL
Affinity DataIC50: 2nMAssay Description:Inhibition of CDK2/Cyclin E (unknown origin) expressed in sf9 cells using histone H1 as substrate in presence of [gamma33P]-ATPMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase 2/G1/S-specific cyclin-E1(Homo sapiens (Human))
Palack£
Curated by ChEMBL
Palack£
Curated by ChEMBL
Affinity DataIC50: 2nMAssay Description:Inhibition of His-tagged CDK2/Cyclin-E1 (unknown origin) expressed in baculovirus infected Sf9 insect cells using histone H1 as substrate measured in...More data for this Ligand-Target Pair
TargetCyclin-T1/Cyclin-dependent kinase 9(Homo sapiens (Human))
China Pharmaceutical University
Curated by ChEMBL
China Pharmaceutical University
Curated by ChEMBL
Affinity DataIC50: 2.70nMAssay Description:Inhibition of human CDK9/cyclin-T1 using KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC as substrate incubated for 2 hrs by [gamma-33P]-ATP assayMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase 2(Homo sapiens (Human))
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Affinity DataIC50: <3nMAssay Description:Inhibition of CDK2 (unknown origin)More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 1(Homo sapiens (Human))
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Affinity DataIC50: 3nMAssay Description:Inhibition of CDK1 (unknown origin) expressed in baculovirus infected Sf9 insect cells using histone H1 as substrate after 1 hr by liquid scintillati...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 1(Homo sapiens (Human))
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Affinity DataIC50: 3nMAssay Description:Inhibition of recombinant CDK1 (unknown origin) expressed in baculovirus infected Sf9 cells using biotinylated Histone H1 peptide as substrate incuba...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
University Of Nebraska Medical Center
Curated by ChEMBL
University Of Nebraska Medical Center
Curated by ChEMBL
Affinity DataIC50: 3nMAssay Description:Inhibition of recombinant CDK1/cyclin B (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated histone H1 as substrat...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 1(Homo sapiens (Human))
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Affinity DataIC50: 3nMAssay Description:Inhibition of CDK1 (unknown origin)More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 1(Homo sapiens (Human))
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Affinity DataIC50: 3nMAssay Description:Inhibition of recombinant CDK1 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated peptide as substrate after 1 hr...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 1(Homo sapiens (Human))
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Affinity DataIC50: 3nMAssay Description:Inhibition of recombinant CDK1 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated-histone H1 as substrate incubat...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 1(Homo sapiens (Human))
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Affinity DataIC50: 3nMAssay Description:Inhibition of CDK1 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 3nMAssay Description:Inhibition of CDK2/Cyclin A1 (unknown origin) at 1 uM using histone H1 as substrate preincubated for 20 mins followed by 33P-ATP addition and measure...More data for this Ligand-Target Pair
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
University Of Nebraska Medical Center
Curated by ChEMBL
University Of Nebraska Medical Center
Curated by ChEMBL
Affinity DataIC50: 3nMAssay Description:Inhibition of GST-tagged CDK2/Cyclin-A2 (unknown origin) expressed in Escherichia coli using histone H1 as substrate measured in presence of [gamma-3...More data for this Ligand-Target Pair
Affinity DataIC50: <3nMAssay Description:Inhibition of CDK9 (unknown origin)More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 1(Homo sapiens (Human))
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Affinity DataIC50: 3nMAssay Description:Inhibition of recombinant CDK1 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated Histone H1 as substrate after 1...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 2/G1/S-specific cyclin-E1(Homo sapiens (Human))
Palack£
Curated by ChEMBL
Palack£
Curated by ChEMBL
Affinity DataIC50: 3nMAssay Description:Inhibition of His-tagged CDK2/cyclin E1 (unknown origin) expressed in Sf9 cells using histone H1 as substrate in presence of ATP and [gamma33-P]ATP b...More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 1(Homo sapiens (Human))
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Affinity DataIC50: 3nMAssay Description:Inhibition of CDK1 (unknown origin)More data for this Ligand-Target Pair
TargetCyclin-dependent kinase 1(Homo sapiens (Human))
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Csir-Indian Institute Of Integrative Medicine
Curated by ChEMBL
Affinity DataIC50: 3nMAssay Description:Inhibition of CDK1 (unknown origin)More data for this Ligand-Target Pair
Affinity DataIC50: 4nMAssay Description:Inhibition of recombinant CDK9 (unknown origin) expressed in baculovirus infected Sf9 insect cells using biotinylated Histone H1 as substrate after 1...More data for this Ligand-Target Pair
Affinity DataIC50: 4nMAssay Description:Inhibition of CDK9 (unknown origin)More data for this Ligand-Target Pair