TargetSerine/threonine-protein kinase PLK2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: 310nMAssay Description:Inhibition of human recombinant PLK2 using recombinant dephosphorylated bovine alpha- casein as substrate after 30 mins by scintillation counting ana...More data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase PLK2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: 350nMAssay Description:Inhibition of human recombinant PLK2 using recombinant dephosphorylated bovine alpha- casein as substrate after 30 mins by scintillation counting ana...More data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase PLK2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: 374nMAssay Description:Inhibition of human PLK2 using casein as substrateMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase PLK2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: 470nMAssay Description:Inhibition of human recombinant PLK2 using recombinant dephosphorylated bovine alpha- casein as substrate after 30 mins by scintillation counting ana...More data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase Nek1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: 630nMAssay Description:Inhibition of human NEK1 using MBP as substrateMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase PLK2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: 1.07E+3nMAssay Description:Inhibition of human recombinant PLK2 using recombinant dephosphorylated bovine alpha- casein as substrate after 30 mins by scintillation counting ana...More data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase PLK2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: 1.23E+3nMAssay Description:Inhibition of human recombinant PLK2 using recombinant dephosphorylated bovine alpha- casein as substrate after 30 mins by scintillation counting ana...More data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase Nek2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: 1.83E+3nMAssay Description:Inhibition of human NEK2 using MBP as substrateMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase Nek5(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: 4.42E+3nMAssay Description:Inhibition of human NEK5 using MBP as substrateMore data for this Ligand-Target Pair
TargetEphrin type-A receptor 6(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >5.00E+3nMAssay Description:Inhibition of human EPHA6 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
TargetFibroblast growth factor receptor 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >5.00E+3nMAssay Description:Inhibition of human FGFR1 using [KKKSPGEYVNIEFG] as substrateMore data for this Ligand-Target Pair
TargetFibroblast growth factor receptor 3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >5.00E+3nMAssay Description:Inhibition of human FGFR3 using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase Nek9(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >5.00E+3nMAssay Description:Inhibition of human NEK9 using MBP as substrateMore data for this Ligand-Target Pair
TargetReceptor-type tyrosine-protein kinase FLT3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >5.00E+3nMAssay Description:Inhibition of human FLT3 using [EAIYAAPFAKKK] as substrateMore data for this Ligand-Target Pair
TargetGlycogen synthase kinase-3 alpha(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >5.00E+3nMAssay Description:Inhibition of human GSK3alpha using [YRRAAVPPSPSLSRHSSPHQ(pS)EDEEE] as substrateMore data for this Ligand-Target Pair
TargetTestis-specific serine/threonine-protein kinase 3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >5.00E+3nMAssay Description:Inhibition of human TSSK3 using [KKKVSRSGLYRSPSMPENLNRPR] as substrateMore data for this Ligand-Target Pair
TargetRibosomal protein S6 kinase alpha-1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >5.00E+3nMAssay Description:Inhibition of human RSK1 using [KKLNRTLSVA] as substrateMore data for this Ligand-Target Pair
TargetTRAF2 and NCK-interacting protein kinase(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >5.00E+3nMAssay Description:Inhibition of human TNIK using [RLGRDKYKTLRQIRQ] as substrateMore data for this Ligand-Target Pair
TargetHigh affinity nerve growth factor receptor(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >5.00E+3nMAssay Description:Inhibition of human TRKA using poly[Glu:Tyr] (4:1) as substrateMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase PLK2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: 6.08E+3nMAssay Description:Inhibition of human recombinant PLK2 using recombinant dephosphorylated bovine alpha- casein as substrate after 30 mins by scintillation counting ana...More data for this Ligand-Target Pair
TargetCalcium/calmodulin-dependent protein kinase type II subunit gamma(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CAMK2gamma using [KKLNRTLSFAEPG] as substrateMore data for this Ligand-Target Pair
TargetCalcium/calmodulin-dependent protein kinase type IV(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CAMK4 using [KKLNRTLSFAEPG] as substrateMore data for this Ligand-Target Pair
TargetCalcium/calmodulin-dependent protein kinase kinase 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CAMKK1 using MBP as substrateMore data for this Ligand-Target Pair
TargetCalcium/calmodulin-dependent protein kinase kinase 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CAMKK2 using MBP as substrateMore data for this Ligand-Target Pair
TargetCell division cycle 7-related protein kinase/Protein DBF4 homolog A(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDC7/DBF4 using [KTFCGTPEYLAPEVRREPRILSEEEQEMFRDFDYIADWC] as substrateMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase/G2/mitotic-specific cyclin- 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDK1/cyclin B using histone H1 as substrateMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase/G1/S-specific cyclin- 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDK1/cyclin E using RP protein as substrateMore data for this Ligand-Target Pair
TargetCyclin-A2/Cyclin-dependent kinase 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDK2/cyclin A using histone H1 as substrateMore data for this Ligand-Target Pair
TargetCyclin-A1/Cyclin-dependent kinase 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDK2/Cyclin A1 using histone H1 as substrateMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase 2/G1/S-specific cyclin-E1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDK2/cyclin E using histone H1 as substrateMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase 3/G1/S-specific cyclin-E1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDK3/cyclin E using histone H1 as substrateMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDK4/cyclin D1 using RB-CTF as substrateMore data for this Ligand-Target Pair
TargetCyclin-dependent kinase 4/G1/S-specific cyclin-D3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human CDK4/cyclin D3 using RB-CTF as substrateMore data for this Ligand-Target Pair
TargetMAP kinase-activated protein kinase 3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MAPKAPK3 using [KKLNRTLSVA] as substrateMore data for this Ligand-Target Pair
TargetMAP kinase-activated protein kinase 5(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MAPKAPK5 using [KKLNRTLSVA] as substrateMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase MARK1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MARK1 using [KKKVSRSGLYRSPSMPENLNRPR] as substrateMore data for this Ligand-Target Pair
TargetSerine/threonine-protein kinase MARK2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MARK2 using [KKKVSRSGLYRSPSMPENLNRPR] as substrateMore data for this Ligand-Target Pair
TargetMAP/microtubule affinity-regulating kinase 3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MARK3 using [KKKVSRSGLYRSPSMPENLNRPR] as substrateMore data for this Ligand-Target Pair
TargetMAP/microtubule affinity-regulating kinase 4(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MARK4 using [KKKVSRSGLYRSPSMPENLNRPR] as substrateMore data for this Ligand-Target Pair
TargetDual specificity mitogen-activated protein kinase kinase 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MEK1 using ERK2 as substrateMore data for this Ligand-Target Pair
TargetDual specificity mitogen-activated protein kinase kinase 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MEK2 using ERK2 as substrateMore data for this Ligand-Target Pair
TargetDual specificity mitogen-activated protein kinase kinase 3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MEK3 using p38alpha as substrateMore data for this Ligand-Target Pair
TargetMitogen-activated protein kinase kinase kinase 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MEKK1 using MBP as substrateMore data for this Ligand-Target Pair
TargetMitogen-activated protein kinase kinase kinase 2(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MEKK2 using MBP as substrateMore data for this Ligand-Target Pair
TargetMitogen-activated protein kinase kinase kinase 3(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MEKK3 using MBP as substrateMore data for this Ligand-Target Pair
TargetMaternal embryonic leucine zipper kinase(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MELK using [KKLNRTLSFAEPG] as substrateMore data for this Ligand-Target Pair
TargetMisshapen-like kinase 1(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MINK using MBP as substrateMore data for this Ligand-Target Pair
TargetDual specificity mitogen-activated protein kinase kinase 4(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MKK4More data for this Ligand-Target Pair
TargetDual specificity mitogen-activated protein kinase kinase 6(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MKK6 using p38alpha as substrateMore data for this Ligand-Target Pair
TargetMyosin light chain kinase, smooth muscle(Homo sapiens (Human))
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Icahn School Of Medicine At Mount Sinai
Curated by ChEMBL
Affinity DataIC50: >1.00E+4nMAssay Description:Inhibition of human MLCK using [KKLNRTLSFAEPG] as substrateMore data for this Ligand-Target Pair