| Reaction Details |
|---|
| Cell Reactant | Glyoxylate Regulatory Protein (C-AllR) |
|---|
| Syringe Reactant | Glyoxylate |
|---|
| Meas. Tech. | Isothermal Titration Calorimetry |
|---|
| Entry Date | 12/10/07 |
|---|
| |
| ΔG° | -4.4308±n/a (kJ/mole) |
|---|
| pH | 7.4±n/a |
|---|
| Log10Kb | 5±
4.5 |
|---|
| Temperature | 298.15±n/a (K) |
|---|
| ΔH° | n/a |
|---|
| ΔHobs | -34.276±n/a (kJ/mole) |
|---|
| Ionic Strength | n/a |
|---|
| Corrected for ΔHioniz | no |
|---|
| Protons Released | n/a |
|---|
| ΔCp | n/a |
|---|
| Stoich. Param. | 0.5 |
|---|
| ΔS° | -0.1011±n/a (kJ/mole-K) |
|---|
| Comments | n/a |
|---|
| |
| Citation |  Lorca, GL; Ezersky, A; Lunin, VV; Walker, JR; Altamentova, S; Evdokimova, E; Vedadi, M; Bochkarev, A; Savchenko, A Glyoxylate and pyruvate are antagonistic effectors of the Escherichia coli IclR transcriptional regulator.J Biol Chem.282:16476-91(2007)[PubMed] |
|---|
| More Info. |
Get all data from this article
, ITC RUN data
, Solution Info
, Data Fit Method
, Instrument Info
|
|---|
| |
| Glyoxylate Regulatory Protein (C-AllR) |
|---|
| Source | His-tagged fusion protein was overexpressed and purified in E. coli. |
|---|
| Purity | n/a |
|---|
| Prep. Method | The His6 tag was cleaved from the protein by tobacco etch virus protease. The cleaved protein was then resolved by flowing the mixture through a second Ni2+ column. The purified proteins were dialyzed and concentrated. |
|---|
| Name | Glyoxylate Regulatory Protein (C-AllR) |
|---|
| Synonyms | Negative regulator of allantoin and glyoxylate utilization operons | Transcriptional regulator AllR, C-terminal domain |
|---|
| Type | C-terminal effector-binding domain |
|---|
| Mol. Mass. | n/a |
|---|
| Organism | Escherichia coli |
|---|
| Description | n/a |
|---|
| Residue | 198 |
|---|
| Sequence | MGSSHHHHHHSSGRENLYFQGHMDVLSVAGPFMRRLMLLSGETVNVAIRNGNEAVLIGQL
ECKSMVRMCAPLGSRLPLHASGAGKALLYPLAEEELMSIILQTGLQQFTPTTLVDMPTLL
KDLEQARELGYTVDKEEHVVGLNCIASAIYDDVGSVVAAISISGPSSRLTEDRFVSQGEL
VRDTARDISTALGLKAHP
| |
|
|---|
| Glyoxylate |
|---|
| Source | n/a |
|---|
| Purity | n/a |
|---|
| Prep. Method | n/a |
|---|
| Name | Glyoxylate |
|---|
| Synonyms: | 2-oxoacetic acid | Oxoethanoic acid | glyoxylic acid | oxaldehydic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C2H2O3 |
|---|
| Mol. Mass. | 74.0355 |
|---|
| SMILES | OC(=O)C=O |
|---|
| Structure | |
|---|