Cell Reactant:
Major Urinary Protein (MUP-1)
Syringe Reactant:
BDBM22605
Meas. Tech.:
Isothermal Titration Calorimetry
Entry Date.:
06/15/08
ΔG°:
-7.78±0.01 (kcal/mole)
pH:
7.4±n/a
Temperature:
300±n/a (K)
ΔHobs :
-12.78±0.1 (kJ/mole)
Corrected for ΔHioniz:
no
Stoich. Param.:
1.05
ΔS° :
-0.02±0 (kJ/mole-K)
Citation
 Malham, RJohnstone, SBingham, RJBarratt, EPhillips, SELaughton, CAHomans, SW Strong solute-solute dispersive interactions in a protein-ligand complex. J Am Chem Soc 127:17061-7 (2005) [PubMed]  Article
Cell React
Source:
The MUP-1 gene was cloned and expressed in E. coli cells.
Prep. Method:
MUP-I was purified using Ni-NTA resin. To remove endogenous bound ligands, an ethanol precipitation step was utilized involving addition of 2 volumes of absolute ethanol per volume of protein solution, followed by incubation at 4 C for 2 h. After centrifugation at 5000g, the pellet was lyophilised, resuspended in PBS pH 7.4, and dialyzed overnight against the same buffer.
Name:
Major Urinary Protein (MUP-1)
Synonyms:
Major urinary protein 1 precursor
Type:
Other Protein Type
Mol. Mass.:
20640.17
Organism:
Mus musculus (mouse)
Description:
n/a
Residue:
180
Sequence:
MKMLLLLCLGLTLVCVHAEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEKHGILRENIIDLSNANRCLQARE
  
Syringe React
Name:
BDBM22605
Synonyms:
Heptan-1-ol | Heptyl alcohol
Type:
Small organic molecule
Emp. Form.:
C7H16O
Mol. Mass.:
116.2013
SMILES:
CCCCCCCO
Structure:
Search PDB for entries with ligand similarity: