BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:apocytochrome b562
Syringe Reactant:BDBM20
Meas. Tech.:ITC
Entry Date:12/04/00
 
ΔG°:-7.64±0.600 (kcal/mole)
pH:8.5±n/a
Log10Kb:5.52± 4.90
Temperature:298.15±n/a (K)
ΔH° :-2.01± (kcal/mole)
ΔHobs :-2.01± (kcal/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° :0.0200±0.0700 (kcal/mole-K)
Comments:binding is very tight, limiting the accuracy of calorimetric measurement of the binding constant to approximately 25%
 
Citation Robinson, CRLiu, YThomson, JASturtevant, JMSligar, SG Energetics of heme binding to native and denatured states of cytochrome b562. Biochemistry36:16141-6 (1997) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Instrument Info
 
apocytochrome b562
Source:E.coli
Purity:n/a
Prep. Method:Thermal denaturation
Name:apocytochrome b562
Synonyms:apocytochrome b562(denatured) | denatured apocytochrome b562
Type:Protein
Mol. Mass.:14060.82
Organism:Escherichia coli
Description:P0ABE7
Residue:128
Sequence:
MRKSLLAILAVSSLVFSSASFAADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAAL
DAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTR
NAYHQKYR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM20
Source:Sigma Chemical Co.
Purity:n/a
Prep. Method:dissolved in NaOH and diluted with buffer
NameBDBM20
Synonyms:3-[5-(2-carboxyethyl)-15,20-diethenyl-22-hydroxy-4,10,14,19,24-pentamethyl-21,23,24,25-tetraaza-22-ferrahexacyclo[9.9.3.1^{3,6}.1^{13,16}.0^{8,23}.0^{18,21}]pentacosa-1(20),3,5,8,10,13,15,18-octaen-9-yl]propanoic acid | Hematin(iron protoporphyrin IX)
TypePorphyrin
Emp. Form.C35H40N4O4
Mol. Mass.580.7176
SMILESCc1c2Cc3[n-]c(Cc4c(C=C)c(C)c(Cc5[n-]c(Cc([nH]2)c1CCC(O)=O)c(CCC(O)=O)c5C)n4C)c(C)c3C=C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.