BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Transcriptional Regulator TtgR
Syringe Reactant:BDBM7460
Meas. Tech.:Isothermal Titration Calorimetry
Entry Date:07/23/08
 
ΔG°:-8.09±0.0300 (kcal/mole)
pH:7±n/a
Log10Kb:5.83± 4.51
Temperature:303.15±n/a (K)
ΔH° :n/a
ΔHobs :-8.93±0.220 (kcal/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:no
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° :0±0 (kcal/mole-K)
Comments:n/a
 
Citation Terán, WKrell, TRamos, JLGallegos, MT Effector-repressor interactions, binding of a single effector molecule to the operator-bound TtgR homodimer mediates derepression. J Biol Chem281:7102-9 (2006) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Data Fit Method ,  Instrument Info
 
Transcriptional Regulator TtgR
Source:A 651-bp fragment containing the ttgR gene was amplified by PCR from P. putida DOT-T1E chromosomal DNA, and cloned in E. coli expression vector. TtgR protein was over-expressed and purified.
Purity:n/a
Prep. Method:TtgR protein was further purified by size exclusion chromatography using a Sephacryl HR-200 column (Amersham Biosciences). Eluted fractions of TtgR were pooled, concentrated, and dialyzed against the buffer.
Name:Transcriptional Regulator TtgR
Synonyms:HTH-type transcriptional regulator ttgR | Toluene efflux pump ttgABC operon repressor
Type:Repressor; homodimer
Mol. Mass.:23852.57
Organism:Pseudomonas putida
Description:n/a
Residue:210
Sequence:
MVRRTKEEAQETRAQIIEAAERAFYKRGVARTTLADIAELAGVTRGAIYWHFNNKAELVQ
ALLDSLHETHDHLARASESEDEVDPLGCMRKLLLQVFNELVLDARTRRINEILHHKCEFT
DDMCEIRQQRQSAVLDCHKGITLALANAVRRGQLPGELDAERAAVAMFAYVDGLIRRWLL
LPDSVDLLGDVEKWVDTGLDMLRLSPALRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM7460
Source:n/a
Purity:n/a
Prep. Method:All chemicals were manipulated in glass vessels and effector samples were neither degassed nor filtered, to avoid evaporation or nonspecific binding.
NameBDBM7460
Synonyms:2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-4H-chromen-4-one | 2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-chromen-4-one | 2-(3,4-dihydroxyphenyl)-3,5,7-trihydroxy-chromone;hydrate | CHEMBL50 | Quercetin | Quercetin (10) | Quercetin (21) | Quercetin (Qur) | US9180183, Quercetin
TypeSmall organic molecule
Emp. Form.C15H10O7
Mol. Mass.302.2357
SMILESOc1cc(O)c2c(c1)oc(-c1ccc(O)c(O)c1)c(O)c2=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.