BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Transcriptional Regulator TtgR Mutant R176G
Syringe Reactant:BDBM19461
Meas. Tech.:Isothermal Titration Calorimetry
Entry Date:07/23/08
 
ΔG°:-6.30±0.600 (kcal/mole)
pH:7±n/a
Log10Kb:4.54± 3.48
Temperature:303.15±n/a (K)
ΔH° :n/a
ΔHobs :-24.9±3.5 (kcal/mole)
Ionic Strength:n/a
Corrected for ΔHioniz:no
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° :-0.0600±0.0100 (kcal/mole-K)
Comments:n/a
 
Citation Alguel, YDe Lucca, GVLiang, JMeng, CTerán, WDe Lucca, IKrell, TRamos, JLGallegos, MTZhang, X Crystal structures of multidrug binding protein TtgR in complex with antibiotics and plant antimicrobials. J Mol Biol369:829-40 (2007) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info ,  Data Fit Method ,  Instrument Info
 
Transcriptional Regulator TtgR Mutant R176G
Source:Site-directed mutant was cloned, and protein was expressed and purified from E. coli.
Purity:n/a
Prep. Method:TtgR mutant protein was further purified by size exclusion chromatography using a Sephacryl HR-200 column (Amersham Biosciences). Eluted fractions of TtgR were pooled, concentrated, and dialyzed against the buffer.
Name:Transcriptional Regulator TtgR Mutant R176G
Synonyms:HTH-type transcriptional regulator ttgR | Toluene efflux pump ttgABC operon repressor
Type:Repressor; homodimer
Mol. Mass.:23752.43
Organism:Pseudomonas putida
Description:n/a
Residue:210
Sequence:
MVRRTKEEAQETRAQIIEAAERAFYKRGVARTTLADIAELAGVTRGAIYWHFNNKAELVQ
ALLDSLHETHDHLARASESEDEVDPLGCMRKLLLQVFNELVLDARTRRINEILHHKCEFT
DDMCEIRQQRQSAVLDCHKGITLALANAVRRGQLPGELDAERAAVAMFAYVDGLIGRWLL
LPDSVDLLGDVEKWVDTGLDMLRLSPALRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM19461
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM19461
Synonyms:α-CA inhibitor, 5 | 5,7-dihydroxy-2-(4-hydroxyphenyl)-3,4-dihydro-2H-1-benzopyran-4-one | CHEMBL32571 | Naringenin | Naringenin (NAR) | naringetol | salipurpol
TypeEstrgen Antagonist
Emp. Form.C15H12O5
Mol. Mass.272.2528
SMILESOc1ccc(cc1)C1CC(=O)c2c(O)cc(O)cc2O1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.