BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Cell Reactant:Phosphoehtnaolamine Methyltransferases 1 (PMT1)
Syringe Reactant:BDBM28422
Meas. Tech.:Enzyme Inhibition
Entry Date:09/18/12
 
ΔG°:-6.70±0.480 (kcal/mole)
pH:7.5±0
Log10Kb:n/a
Temperature:283.15±0 (K)
ΔH° :-6.70±0.100 (kcal/mole)
ΔHobs:n/a
Ionic Strength:n/a
Corrected for ΔHioniz:n/a
Protons Released:n/a
ΔCp :n/a
Stoich. Param.:n/a
ΔS° :0±0 (kcal/mole-K)
Comments:n/a
 
Citation Lee, SGHaakenson, WMcCarter, JPWilliams, DJHresko, MCJez, JM Thermodynamic evaluation of ligand binding in the plant-like phosphoethanolamine methyltransferases of the parasitic nematode Haemonchus contortus. J Biol Chem286:38060-8 (2011) [PubMed]  Article
More Info.:  Get all data from this article ,  ITC RUN data ,  Solution Info
 
Phosphoehtnaolamine Methyltransferases 1 (PMT1)
Source:n/a
Purity:n/a
Prep. Method:n/a
Name:Phosphoehtnaolamine Methyltransferases 1 (PMT1)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:53531.36
Organism:Caenorhabditis elegans
Description:Q86NB3
Residue:460
Sequence:
MVNVRRANFKSFWDKYSDKPDTNSMMLNHSAEELESSDRADILASLPLLHNKDVVDIGAG
IGRFTTVLAETARWVLSTDFIDSFIKKNQERNAHLGNINYQVGDAVGLKMESNSVDLVFT
NWLMMYLSDEETVEFIFNCMRWLRSHGIVHLRESCSEPSTGRSKAKSMHDTANANPTHYR
FSSLYINLLRAIRYRDVDNKLWRFNVQWSCSVPTYIKRSNNWRQVHWLAEKVPAEDGAKG
TSFNELVELIKNTWQNEQEAWDAKLDDEKYVWTDKVFSSALTSLPSNSTFFLYTPRTVSP
YCHINAHTLAETFNANVWNTEIIPEYYRTSLTKSNNLKDQRVRFGWNQSLTDSVTYWQQK
DALFDVFVATEFLSTVDDETIRQLPNVMSDGAKFITLEPVDEVNEAEMKQRIQELGYTLK
SFTDVTDQCIEAQEQYFKDHEQLRDEKVIRKNWVLLELTH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM28422
Source:n/a
Purity:n/a
Prep. Method:n/a
NameBDBM28422
Synonyms:(2S)-2-amino-4-({[(2S,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-3,4-dihydroxyoxolan-2-yl]methyl}(methyl)sulfanylium)butanoate | AdoMet | S-Adenosylmethionine | S-adenosyl-L-[carboxy-14C]methionine | [14COOH]AdoMet
Typeradiolabeled substrate
Emp. Form.C15H22N6O5S
Mol. Mass.398.437
SMILESC[S+](CC[C@H](N)C([O-])=O)C[C@H]1O[C@H]([C@H](O)[C@@H]1O)n1cnc2c(N)ncnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:

   
    

Home

|

Search

|

Deposit

|

SiteMap

|

About us

|

Email us

|

Info

 
Last update November 1, 2007
©2000 BindingDB. All rights reserved.