Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAnthrax Lethal Factor (LF)
LigandBDBM8439
Substrate/CompetitorMAPKKide
Meas. Tech.Fluorescence Peptide Cleavage Assay
IC50 500±n/a nM
Citation Forino, MJohnson, SWong, TYRozanov, DVSavinov, AYLi, WFattorusso, RBecattini, BOrry, AJJung, DAbagyan, RASmith, JWAlibek, KLiddington, RCStrongin, AYPellecchia, M Efficient synthetic inhibitors of anthrax lethal factor. Proc Natl Acad Sci U S A102:9499-504 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Anthrax Lethal Factor (LF)
Name:Antrax lethal toxin
Synonyms:Anthrax lethal factor | lethal factor
Type:PROTEIN
Mol. Mass.:93758.56
Organism:Bacillus anthracis
Description:ChEMBL_1460338
Residue:809
Sequence:
MNIKKEFIKVISMSCLVTAITLSGPVFIPLVQGAGGHGDVGMHVKEKEKNKDENKRKDEE
RNKTQEEHLKEIMKHIVKIEVKGEEAVKKEAAEKLLEKVPSDVLEMYKAIGGKIYIVDGD
ITKHISLEALSEDKKKIKDIYGKDALLHEHYVYAKEGYEPVLVIQSSEDYVENTEKALNV
YYEIGKILSRDILSKINQPYQKFLDVLNTIKNASDSDGQDLLFTNQLKEHPTDFSVEFLE
QNSNEVQEVFAKAFAYYIEPQHRDVLQLYAPEAFNYMDKFNEQEINLSLEELKDQRMLAR
YEKWEKIKQHYQHWSDSLSEEGRGLLKKLQIPIEPKKDDIIHSLSQEEKELLKRIQIDSS
DFLSTEEKEFLKKLQIDIRDSLSEEEKELLNRIQVDSSNPLSEKEKEFLKKLKLDIQPYD
INQRLQDTGGLIDSPSINLDVRKQYKRDIQNIDALLHQSIGSTLYNKIYLYENMNINNLT
ATLGADLVDSTDNTKINRGIFNEFKKNFKYSISSNYMIVDINERPALDNERLKWRIQLSP
DTRAGYLENGKLILQRNIGLEIKDVQIIKQSEKEYIRIDAKVVPKSKIDTKIQEAQLNIN
QEWNKALGLPKYTKLITFNVHNRYASNIVESAYLILNEWKNNIQSDLIKKVTNYLVDGNG
RFVFTDITLPNIAEQYTHQDEIYEQVHSKGLYVPESRSILLHGPSKGVELRNDSEGFIHE
FGHAVDDYAGYLLDKNQSDLVTNSKKFIDIFKEEGSNLTSYGRTNEAEFFAEAFRLMHST
DHAERLKVQKNAPKTFQFINDQIKFIINS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM8439
NameBDBM8439
Synonyms:2-[(5Z)-5-{[5-(4-chloro-2-nitrophenyl)furan-2-yl]methylidene}-4-oxo-2-sulfanylidene-1,3-thiazolidin-3-yl]acetic acid | BI-11A11 | Rhodanine analogue | {5-[5-(4-Chloro-2-nitro-phenyl)-furan-2-ylmethylene]-4-oxo-2-thioxo-thiazolidin-3-yl}-acetic acid
TypeSmall organic molecule
Emp. Form.C16H9ClN2O6S2
Mol. Mass.424.835
SMILESOC(=O)CN1C(=S)S\C(=C/c2ccc(o2)-c2ccc(Cl)cc2N(=O)=O)C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
MAPKKide
Name:MAPKKide
Synonyms:n/a
Type:Peptide
Mol. Mass.:358.43
Organism:n/a
Description:MAPPKKide is a quenched fluoresent substrate peptide based on fluorescence resonance energy transfer (FRET). The C-terminally linked fluorophore of MAPKKide is a FITC, and the acceptor chromophore is 4-([4-(dimethylamino)-phenyl] azo) benzoic acid (DABCYL) (List Biological Laboratories, Inc, Campbell, CA).
Residue:3
Sequence:
n/a