Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMAP kinase-interacting serine/threonine-protein kinase 1 (MKNK1)
LigandBDBM176746
Substrate/Competitorn/a
Meas. Tech.MKNK1 Kinase High ATP Assay
pH7.5±n/a
IC50 87±n/a nM
Commentsextracted
Citation Klar, UWortmann, LGraham, KPuehler, FSülzle, DKettschau, GLienau, P Substituted thiazolopyrimidines US Patent US9675612 Publication Date 6/13/2017  Article
More Info.:Get all data from this article,  Assay Method
 
MAP kinase-interacting serine/threonine-protein kinase 1 (MKNK1)
Name:MAP kinase-interacting serine/threonine-protein kinase 1 (MKNK1)
Synonyms:MAP kinase signal-integrating kinase 1 (MNK1) (T344D) | MAP kinase-interacting serine/threonine-protein kinase 1 (MKNK1) (T344D) | MAP kinase-interacting serine/threonine-protein kinase 1 (MKNK1)(T344D) | MNK1a
Type:Protein
Mol. Mass.:47416.00
Organism:Homo sapiens (Human)
Description:Q9BUB5-2 with T344D
Residue:424
Sequence:
MVSSQKLEKPIEMGSSEPLPIADGDRRRKKKRRGRATDSLPGKFEDMYKLTSELLGEGAY
AKVQGAVSLQNGKEYAVKIIEKQAGHSRSRVFREVETLYQCQGNKNILELIEFFEDDTRF
YLVFEKLQGGSILAHIQKQKHFNEREASRVVRDVAAALDFLHTKGIAHRDLKPENILCES
PEKVSPVKICDFDLGSGMKLNNSCTPITTPELTTPCGSAEYMAPEVVEVFTDQATFYDKR
CDLWSLGVVLYIMLSGYPPFVGHCGADCGWDRGEVCRVCQNKLFESIQEGKYEFPDKDWA
HISSEAKDLISKLLVRDAKQRLSAAQVLQHPWVQGQAPEKGLPDPQVLQRNSSTMDLTLF
AAEAIALNRQLSQHEENELAEEPEALADGLCSMKLSPPCKSRLARRRALAQAGRGEDRSP
PTAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM176746
NameBDBM176746
Synonyms:US9675612, 2 6-[(2-Cyclobutyl[1,3]thiazolo[5,4-d]pyrimidin-7-yl)amino]-1,3-benzothiazol-2(3H)-one
TypeSmall organic molecule
Emp. Form.C16H13N5OS2
Mol. Mass.355.437
SMILESO=c1[nH]c2ccc(Nc3ncnc4sc(nc34)C3CCC3)cc2s1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a