Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSigma intracellular receptor 2
LigandBDBM50374606
Substrate/Competitorn/a
Meas. Tech.Receptor Assay
Ki 8.74±2.30 nM
Citation McCurdy, CRMesangeau, CChin, FTJames, MLShen, BGambhir, S Highly selective sigma receptor radioligands US Patent US9604926 Publication Date 3/28/2017  Article
More Info.:Get all data from this article,  Assay Method
 
Sigma intracellular receptor 2
Name:Sigma intracellular receptor 2
Synonyms:S2r | Sigma-2 receptor | Sigma2 receptor | Tmem97 | Transmembrane protein 97
Type:n/a
Mol. Mass.:20818.69
Organism:Mus musculus (Mouse)
Description:Q8VD00
Residue:176
Sequence:
MGALAARRCVEWLLGLYFVSHIPITLFIDLQAVLPPELYPQEFSNLLRWYSKEFKDPLMQ
EPPVWFKSFLLCELVFQLPFFPIAAYAFFKGSCRWIRIPAIIYAAHTITTLIPILYTLLF
EDFSKAVAFKGQRPESFRERLTLVGVYAPYLIIPLILLLFMLRNPYYKYEEKRKKK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50374606
NameBDBM50374606
Synonyms:CHEMBL405925 | US9604926, Compound CM-124 | US9724435, Compound CM-124
TypeSmall organic molecule
Emp. Form.C20H29N3O2
Mol. Mass.343.4632
SMILESO=c1oc2ccccc2n1CCCN1CCN(CC1)C1CCCCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a