Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFatty acid-binding protein 4 (FABP4)
LigandBDBM312331
Substrate/Competitorn/a
Meas. Tech.Time Resolved-Fluorescence Energy Transfer (TR-FRET) Assay
IC50 20.0±n/a nM
Citation Buettelmann, BCeccarelli, SMKuehne, HKuhn, BNeidhart, WObst Sander, URichter, H Bicyclic thiophenylamide compounds US Patent US9604977 Publication Date 3/28/2017
More Info.:Get all data from this article,  Assay Method
 
Fatty acid-binding protein 4 (FABP4)
Name:Fatty acid-binding protein 4 (FABP4)
Synonyms:A-FABP | AFABP | ALBP | Adipocyte lipid-binding protein | Fatty acid binding protein adipocyte | Fatty acid-binding protein 4
Type:Enzyme
Mol. Mass.:14719.23
Organism:Homo sapiens (Human)
Description:P15090
Residue:132
Sequence:
MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKN
TEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM
KGVTSTRVYERA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM312331
NameBDBM312331
Synonyms:2-[3-(4-Methyl-oxazol-2-yl)-4,7-dihydro-5H-thieno[2,3-c]pyran-2-ylcarbamoyl]-cyclopent-1-enecarboxylic acid | US9604977, Example 78
TypeSmall organic molecule
Emp. Form.C18H18N2O5S
Mol. Mass.374.411
SMILESCc1coc(n1)-c1c(NC(=O)C2=C(CCC2)C(O)=O)sc2COCCc12 |t:12|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a