Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetChitinase Mutant (A217G)
LigandBDBM10850
Substrate/CompetitorBDBM10852
Meas. Tech.ligand-induced quenching of intrinsic tryptophan fluorescence
pH5.5±n/a
Temperature298.15±n/a K
Kd 77000±9000 nM
Citation Rao, FVAndersen, OAVora, KADemartino, JAvan Aalten, DM Methylxanthine drugs are chitinase inhibitors: investigation of inhibition and binding modes. Chem Biol12:973-80 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Chitinase Mutant (A217G)
Name:Chitinase Mutant (A217G)
Synonyms:AfChiB1(A217G) | Class V chitinase ChiB1mutant A217G
Type:Enzyme
Mol. Mass.:47598.95
Organism:Aspergillus fumigatus
Description:n/a
Residue:433
Sequence:
MRFATSTIVKVALLLSSLCVDAAVMWNRDTSSTDLEARASSGYRSVVYFVNWAIYGRNHN
PQDLPVERLTHVLYAFANVRPETGEVYMTDSWADIEKHYPGDSWSDTGNNVYGCIKQLYL
LKKQNRNLKVLLSIGGWTYSPNFAPAASTDAGRKNFAKTAVKLLQDLGFDGLDIDWEYPE
NDQQANDFVLLLKEVRTALDSYSAANAGGQHFLLTVGSPAGPDKIKVLHLKDMDQQLDFW
NLMAYDYAGSFSSLSGHQANVYNDTSNPLSTPFNTQTALDLYRAGGVPANKIVLGMPLYG
RSFANTDGPGKPYNGVGQGSWENGVWDYKALPQAGATEHVLPDIMASYSYDATNKFLISY
DNPQVANLKSGYIKSLGLGGAMWWDSSSDKTGSDSLITTVVNALGGTGVFEQSQNELDYP
VSQYDNLRNGMQT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10850
NameBDBM10850
Synonyms:1-(5-Oxohexyl)theobromine (pentoxifylline) | 3,7-dimethyl-1-(5-oxohexyl)-2,3,6,7-tetrahydro-1H-purine-2,6-dione | 3,7-dimethyl-1-(5-oxohexyl)-3,7-dihydropurine-2,6-dione | CHEMBL628 | Pentoxifylline | Pentoxil | Pentoxyphylline
TypeSmall organic molecule
Emp. Form.C13H18N4O3
Mol. Mass.278.307
SMILESCC(=O)CCCCn1c(=O)n(C)c2ncn(C)c2c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM10852