Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetChitinase Mutant (A217G)
LigandBDBM10853
Substrate/CompetitorBDBM10852
Meas. Tech.ligand-induced quenching of intrinsic tryptophan fluorescence
pH5.5±n/a
Temperature298.15±n/a K
Kd 4240±1150 nM
Km8400±1800 nM
kcat0.1±0.005 1/sec
Citation Rao, FVHouston, DRBoot, RGAerts, JMHodkinson, MAdams, DJShiomi, KOmura, Svan Aalten, DM Specificity and affinity of natural product cyclopentapeptide inhibitors against A. fumigatus, human, and bacterial chitinases. Chem Biol12:65-76 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Chitinase Mutant (A217G)
Name:Chitinase Mutant (A217G)
Synonyms:AfChiB1(A217G) | Class V chitinase ChiB1mutant A217G
Type:Enzyme
Mol. Mass.:47598.95
Organism:Aspergillus fumigatus
Description:n/a
Residue:433
Sequence:
MRFATSTIVKVALLLSSLCVDAAVMWNRDTSSTDLEARASSGYRSVVYFVNWAIYGRNHN
PQDLPVERLTHVLYAFANVRPETGEVYMTDSWADIEKHYPGDSWSDTGNNVYGCIKQLYL
LKKQNRNLKVLLSIGGWTYSPNFAPAASTDAGRKNFAKTAVKLLQDLGFDGLDIDWEYPE
NDQQANDFVLLLKEVRTALDSYSAANAGGQHFLLTVGSPAGPDKIKVLHLKDMDQQLDFW
NLMAYDYAGSFSSLSGHQANVYNDTSNPLSTPFNTQTALDLYRAGGVPANKIVLGMPLYG
RSFANTDGPGKPYNGVGQGSWENGVWDYKALPQAGATEHVLPDIMASYSYDATNKFLISY
DNPQVANLKSGYIKSLGLGGAMWWDSSSDKTGSDSLITTVVNALGGTGVFEQSQNELDYP
VSQYDNLRNGMQT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10853
NameBDBM10853
Synonyms:(2R,5S,8S,11S,15S)-8-benzyl-2,7-dimethyl-5-[3-({[(methylcarbamoyl)amino]methanimidoyl}amino)propyl]-3,6,9,13,17-pentaoxo-1,4,7,10,14-pentaazacycloheptadecane-11,15-dicarboxylic acid | Argifin
TypeSmall organic molecule
Emp. Form.C29H41N9O10
Mol. Mass.675.6901
SMILESCNC(=O)NC(=N)NCCC[C@@H]1NC(=O)[C@@H](C)NC(=O)C[C@H](NC(=O)C[C@H](NC(=O)[C@H](Cc2ccccc2)N(C)C1=O)C(O)=O)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM10852