Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFlap endonuclease 1
LigandBDBM167213
Substrate/Competitorn/a
Meas. Tech.Binding Assay
Ki 691±n/a nM
Citation Eccles, WFitzgerald, AEHack, MDHawryluk, NAJones, WMKeith, JMKrawczuk, PLebsack, ADLiu, JMani, NSMcClure, KJMeduna, SPRosen, MD FLAP modulators US Patent US9732093 Publication Date 8/15/2017  Article
More Info.:Get all data from this article,  Assay Method
 
Flap endonuclease 1
Name:Flap endonuclease 1
Synonyms:DNase IV | FEN-1 | FEN1 | Flap structure-specific endonuclease 1 | MF1 | Maturation factor 1 | RAD2 | hFEN-1
Type:PROTEIN
Mol. Mass.:42602.57
Organism:Homo sapiens (Human)
Description:ChEMBL_1517026
Residue:380
Sequence:
MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGET
TSHLMGMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQLQQAQAAGAE
QEVEKFTKRLVKVTKQHNDECKHLLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDM
DCLTFGSPVLMRHLTASEAKKLPIQEFHLSRILQELGLNQEQFVDLCILLGSDYCESIRG
IGPKRAVDLIQKHKSIEEIVRRLDPNKYPVPENWLHKEAHQLFLEPEVLDPESVELKWSE
PNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSLSSAKRKEPEP
KGSTKKKAKTGAAGKFKRGK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM167213
NameBDBM167213
Synonyms:US9073876, 294 | US9732093, Compound 294
TypeSmall organic molecule
Emp. Form.C16H19FN4O
Mol. Mass.302.3467
SMILESNCCOc1c(F)c(ccc1C1CCC1)-c1cnc(N)cn1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a