Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetABL Mutant (M351T)
LigandBDBM13530
Substrate/CompetitorBDBM13531
Meas. Tech.Kinase Assay and Binding Constant Measurement
pH7.4±n/a
Temperature298.15±n/a K
Kd 10±n/a nM
Citation Carter, TAWodicka, LMShah, NPVelasco, AMFabian, MATreiber, DKMilanov, ZVAtteridge, CEBiggs, WHEdeen, PTFloyd, MFord, JMGrotzfeld, RMHerrgard, SInsko, DEMehta, SAPatel, HKPao, WSawyers, CLVarmus, HZarrinkar, PPLockhart, DJ Inhibition of drug-resistant mutants of ABL, KIT, and EGF receptor kinases. Proc Natl Acad Sci U S A102:11011-6 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
ABL Mutant (M351T)
Name:ABL Mutant (M351T)
Synonyms:Proto-oncogene tyrosine-protein kinase ABL1 mutant M351T | c-ABL | p150
Type:Enzyme
Mol. Mass.:34565.67
Organism:Homo sapiens (human)
Description:n/a
Residue:300
Sequence:
HHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGV
WKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTY
GNLLDYLRECNRQEVNAVVLLYMATQISSATEYLEKKNFIHRDLAARNCLVGENHLVKVA
DFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPY
PGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQES
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM13530
NameBDBM13530
Synonyms:4-[(4-methylpiperazin-1-yl)methyl]-N-[4-methyl-3-[(4-pyridin-3-ylpyrimidin-2-yl)amino]phenyl]benzamide | CHEMBL941 | Gleevec | IMATINIB | Imatinib | Imatinib, 21 | N-(4-methyl-3-{[4-(pyridin-3-yl)pyrimidin-2-yl]amino}phenyl)-4-[(4-methylpiperazin-1-yl)methyl]benzamide | STI-571 | STI571 | US9255107, Imatinib | cid_5291 | imatinib-CD3
TypeSmall organic molecule
Emp. Form.C29H31N7O
Mol. Mass.493.6027
SMILESCN1CCN(Cc2ccc(cc2)C(=O)Nc2ccc(C)c(Nc3nccc(n3)-c3cccnc3)c2)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM13531
NameBDBM13531
Synonyms:4-(4-Fluorophenyl)-2-(4-hydroxyphenyl)-5-(4-pyridyl)-1H-imidazole | 4-[4-(4-Fluorophenyl)-5-(4-pyridinyl)-1H-imidazol-2-yl]phenol | 4-[4-(4-fluorophenyl)-5-(4-pyridyl)-4-imidazolin-2-ylidene]cyclohexa-2,5-dien-1-one | 4-[5-(4-fluorophenyl)-4-(pyridin-4-yl)-1H-imidazol-2-yl]phenol | SB-202190 | SB202190 | biotinylated SB202190
TypeSmall organic molecule
Emp. Form.C20H14FN3O
Mol. Mass.331.3431
SMILESOc1ccc(cc1)-c1nc(c([nH]1)-c1ccc(F)cc1)-c1ccncc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: