Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetABL Mutant (H396P)
LigandBDBM13216
Substrate/CompetitorBDBM13531
Meas. Tech.Kinase Assay and Binding Constant Measurement
Kd 1±n/a nM
Citation Carter, TAWodicka, LMShah, NPVelasco, AMFabian, MATreiber, DKMilanov, ZVAtteridge, CEBiggs, WHEdeen, PTFloyd, MFord, JMGrotzfeld, RMHerrgard, SInsko, DEMehta, SAPatel, HKPao, WSawyers, CLVarmus, HZarrinkar, PPLockhart, DJ Inhibition of drug-resistant mutants of ABL, KIT, and EGF receptor kinases. Proc Natl Acad Sci U S A102:11011-6 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
ABL Mutant (H396P)
Name:ABL Mutant (H396P)
Synonyms:Proto-oncogene tyrosine-protein kinase ABL1 mutant H396P | c-ABL | p150
Type:Enzyme
Mol. Mass.:34555.23
Organism:Homo sapiens (Human)
Description:n/a
Residue:300
Sequence:
HHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGV
WKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTY
GNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVA
DFGLSRLMTGDTYTAPAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPY
PGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQES
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM13216
NameBDBM13216
Synonyms:BMS-354825 | CHEMBL1421 | DASATINIB | N-(2-Chloro-6-methylphenyl)-2-[[6-[4-(2-hydroxyethyl)-1-piperazinyl)]-2-methyl-4-pyrimidinyl]amino)]-1,3-thiazole-5-carboxamide | N-(2-chloro-6-methylphenyl)-2-({6-[4-(2-hydroxyethyl)piperazin-1-yl]-2-methylpyrimidin-4-yl}amino)-1,3-thiazole-5-carboxamide | cid_3062316
TypeSmall organic molecule
Emp. Form.C22H26ClN7O2S
Mol. Mass.488.006
SMILESCc1nc(Nc2ncc(s2)C(=O)Nc2c(C)cccc2Cl)cc(n1)N1CCN(CCO)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM13531
NameBDBM13531
Synonyms:4-(4-Fluorophenyl)-2-(4-hydroxyphenyl)-5-(4-pyridyl)-1H-imidazole | 4-[4-(4-Fluorophenyl)-5-(4-pyridinyl)-1H-imidazol-2-yl]phenol | 4-[4-(4-fluorophenyl)-5-(4-pyridyl)-4-imidazolin-2-ylidene]cyclohexa-2,5-dien-1-one | 4-[5-(4-fluorophenyl)-4-(pyridin-4-yl)-1H-imidazol-2-yl]phenol | SB-202190 | SB202190 | biotinylated SB202190
TypeSmall organic molecule
Emp. Form.C20H14FN3O
Mol. Mass.331.3431
SMILESOc1ccc(cc1)-c1nc(c([nH]1)-c1ccc(F)cc1)-c1ccncc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: