Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetABL Mutant (Y253F)
LigandBDBM13534
Substrate/CompetitorBDBM13531
Meas. Tech.Kinase Assay and Binding Constant Measurement
Kd 20±n/a nM
Citation Carter, TAWodicka, LMShah, NPVelasco, AMFabian, MATreiber, DKMilanov, ZVAtteridge, CEBiggs, WHEdeen, PTFloyd, MFord, JMGrotzfeld, RMHerrgard, SInsko, DEMehta, SAPatel, HKPao, WSawyers, CLVarmus, HZarrinkar, PPLockhart, DJ Inhibition of drug-resistant mutants of ABL, KIT, and EGF receptor kinases. Proc Natl Acad Sci U S A102:11011-6 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
ABL Mutant (Y253F)
Name:ABL Mutant (Y253F)
Synonyms:Proto-oncogene tyrosine-protein kinase ABL1 mutant Y253F | c-ABL | p150
Type:Enzyme
Mol. Mass.:34579.76
Organism:Homo sapiens (Human)
Description:n/a
Residue:300
Sequence:
HHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERTDITMKHKLGGGQFGEVYEGV
WKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTY
GNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVA
DFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPY
PGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQES
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM13534
NameBDBM13534
Synonyms:CHEMBL572878 | N-[4-({4-[(3-methyl-1H-pyrazol-5-yl)amino]-6-(4-methylpiperazin-1-yl)pyrimidin-2-yl}sulfanyl)phenyl]cyclopropanecarboxamide | N-[4-[[4-(4-methylpiperazino)-6-[(5-methyl-1H-pyrazol-3-yl)amino]pyrimidin-2-yl]thio]phenyl]cyclopropanecarboxamide | VX-680 | VX680 | cyclopropane carboxylic acid {4-[4-(4-methyl-piperazin-1-yl)-6-(5-methyl-2H-pyrazol-3-ylamino)-pyrimidin-2ylsulphanyl]-phenyl}-amide
TypeSmall organic molecule
Emp. Form.C23H28N8OS
Mol. Mass.464.586
SMILESCN1CCN(CC1)c1cc(Nc2cc(C)n[nH]2)nc(Sc2ccc(NC(=O)C3CC3)cc2)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM13531
NameBDBM13531
Synonyms:4-(4-Fluorophenyl)-2-(4-hydroxyphenyl)-5-(4-pyridyl)-1H-imidazole | 4-[4-(4-Fluorophenyl)-5-(4-pyridinyl)-1H-imidazol-2-yl]phenol | 4-[4-(4-fluorophenyl)-5-(4-pyridyl)-4-imidazolin-2-ylidene]cyclohexa-2,5-dien-1-one | 4-[5-(4-fluorophenyl)-4-(pyridin-4-yl)-1H-imidazol-2-yl]phenol | SB-202190 | SB202190 | biotinylated SB202190
TypeSmall organic molecule
Emp. Form.C20H14FN3O
Mol. Mass.331.3431
SMILESOc1ccc(cc1)-c1nc(c([nH]1)-c1ccc(F)cc1)-c1ccncc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: