Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein-Tyrosine Phosphatase 1B (PTP1B)
LigandBDBM14264
Substrate/CompetitorBDBM13466
Meas. Tech.Enzymatic Assay
Temperature298.15±n/a K
Ki 1000±n/a nM
Commentsextracted
Citation Wan, ZKLee, JXu, WErbe, DVJoseph-McCarthy, DFollows, BCZhang, YL Monocyclic thiophenes as protein tyrosine phosphatase 1B inhibitors: capturing interactions with Asp48. Bioorg Med Chem Lett16:4941-5 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Protein-Tyrosine Phosphatase 1B (PTP1B)
Name:Protein-Tyrosine Phosphatase 1B (PTP1B)
Synonyms:PTP-1B | PTPase 1B | Tyrosine-protein phosphatase, non-receptor type 1
Type:Enzyme
Mol. Mass.:34670.65
Organism:Homo sapiens (Human)
Description:The catalytic domain of PTP 1B (residues 1-298) was expressed and purified from E. coli.
Residue:298
Sequence:
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLK
CAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWP
DFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD
PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM14264
NameBDBM14264
Synonyms:4-bromo-3-(carboxymethoxy)-5-{4-[(methoxycarbonyl)amino]phenyl}thiophene-2-carboxylic acid | Monocyclic thiophene analog 33
TypeSmall organic molecule
Emp. Form.C15H12BrNO7S
Mol. Mass.430.227
SMILESCOC(=O)Nc1ccc(cc1)-c1sc(C(O)=O)c(OCC(O)=O)c1Br
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM13466
NameBDBM13466
Synonyms:4-Nitrophenyl phosphate disodium salt hexahydrate | 4-nitrophenyl phosphate (pNPP) | disodium (4-nitrophenyl) phosphate | para-nitrophenyl phosphate (pNPP)
TypeSmall organic molecule
Emp. Form.C6H4NO6P
Mol. Mass.217.0739
SMILES[O-][N+](=O)c1ccc(O[P+]([O-])([O-])[O-])cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: