Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRAC-alpha serine/threonine-protein kinase AKT1
LigandBDBM15188
Substrate/CompetitorSer-Thr 6 Peptide
Meas. Tech.Z-LYTE Kinase Assy
pH7.5±n/a
Temperature298.15±n/a K
Ki 20800±n/a nM
IC50 25100±n/a nM
Citation Forino, MJung, DEaston, JBHoughton, PJPellecchia, M Virtual docking approaches to protein kinase B inhibition. J Med Chem48:2278-81 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
RAC-alpha serine/threonine-protein kinase AKT1
Name:RAC-alpha serine/threonine-protein kinase AKT1
Synonyms:AKT phosphorylation (p-AKT) | C-AKT | PKB | PKB alpha | Protein kinase Akt-1 | Protein kinase B | Protein kinase B (AKT1) | Protein kinase B (Akt 1) | Protein kinase B (Akt) | Protein kinase B alpha | Protein kinase B alpha (AKT1) | Proto-oncogene Akt (Akt1) | Proto-oncogene c-Akt (AKT) | Proto-oncogene c-Akt (AKT1) | RAC-PK-alpha | RAC-alpha serine/threonine-protein kinase | RAC-alpha serine/threonine-protein kinase (AKT) | RAC-alpha serine/threonine-protein kinase (AKT1) | RAC-alpha serine/threonine-protein kinase (pAKT)
Type:Enzyme
Mol. Mass.:55681.25
Organism:Homo sapiens (Human)
Description:n/a
Residue:480
Sequence:
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM15188
NameBDBM15188
Synonyms:5-{5-[(1,3-dioxo-2,3-dihydro-1H-inden-2-ylidene)methyl]furan-2-yl}-2-hydroxybenzoic acid | CHEMBL175828 | compound 3 | compound 5378650
TypeSmall organic molecule
Emp. Form.C21H12O6
Mol. Mass.360.3164
SMILES[#8]-[#6](=O)-c1cc(ccc1-[#8])-c1ccc(\[#6]=[#6]-2/[#6](=O)-c3ccccc3-[#6]-2=O)o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
Ser-Thr 6 Peptide
Name:Ser-Thr 6 Peptide
Synonyms:n/a
Type:Peptide
Mol. Mass.:358.43
Organism:n/a
Description:Substrate peptide provided by Z-LYTE assay kit (Invitrogen Corporation).
Residue:3
Sequence:
n/a