Reaction Details |
 | Report a problem with these data |
Target | cAMP-Dependent Protein Kinase (PKA) |
---|
Ligand | BDBM15210 |
---|
Substrate/Competitor | PKA-specific peptide substrate |
---|
Meas. Tech. | PKA In Vitro Enzyme Assay |
---|
IC50 | 5300±n/a nM |
---|
Citation | Collins, I; Caldwell, J; Fonseca, T; Donald, A; Bavetsias, V; Hunter, LJ; Garrett, MD; Rowlands, MG; Aherne, GW; Davies, TG; Berdini, V; Woodhead, SJ; Davis, D; Seavers, LC; Wyatt, PG; Workman, P; McDonald, E Structure-based design of isoquinoline-5-sulfonamide inhibitors of protein kinase B. Bioorg Med Chem14:1255-73 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
cAMP-Dependent Protein Kinase (PKA) |
---|
Name: | cAMP-dependent protein kinase A |
Synonyms: | PKA C-alpha | PKC | Protein Kinase C | Protein Kinase C, bovine brain | cAMP-dependent Protein Kinase, bovine heart | cAMP-dependent protein kinase A | cAMP-dependent protein kinase alpha-catalytic subunit | cAMP-dependent protein kinase, alpha-catalytic subunit |
Type: | Enzyme Complex |
Mol. Mass.: | 40627.77 |
Organism: | Bos taurus (bovine) |
Description: | The PKA holoenzyme purified from bovine heart, exists as an inactive tetrameric complex, which consists of a regulatory dimer associated with two catalytic subunits. It requires cAMP to activate the enzymatic reaction. |
Residue: | 351 |
Sequence: | MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVML
VKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
|
|
|
BDBM15210 |
---|
Name | BDBM15210 |
Synonyms: | CHEMBL148333 | H-8 | Lopac-M-9656 | N-(2-methylaminoethyl)isoquinoline-5-sulfonamide | N-[2-(methylamino)ethyl]isoquinoline-5-sulfonamide |
Type | Small organic molecule |
Emp. Form. | C12H15N3O2S |
Mol. Mass. | 265.331 |
SMILES | CNCCNS(=O)(=O)c1cccc2cnccc12 |
Structure |  |
PKA-specific peptide substrate |
---|
Name: | PKA-specific peptide substrate |
Synonyms: | PKAtide |
Type: | Peptide |
Mol. Mass.: | 1019.14 |
Organism: | n/a |
Description: | n/a |
Residue: | 9 |
Sequence: | |