Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-Dependent Protein Kinase (PKA)
LigandBDBM15210
Substrate/CompetitorPKA-specific peptide substrate
Meas. Tech.PKA In Vitro Enzyme Assay
IC50 5300±n/a nM
Citation Collins, ICaldwell, JFonseca, TDonald, ABavetsias, VHunter, LJGarrett, MDRowlands, MGAherne, GWDavies, TGBerdini, VWoodhead, SJDavis, DSeavers, LCWyatt, PGWorkman, PMcDonald, E Structure-based design of isoquinoline-5-sulfonamide inhibitors of protein kinase B. Bioorg Med Chem14:1255-73 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
cAMP-Dependent Protein Kinase (PKA)
Name:cAMP-dependent protein kinase A
Synonyms:PKA C-alpha | PKC | Protein Kinase C | Protein Kinase C, bovine brain | cAMP-dependent Protein Kinase, bovine heart | cAMP-dependent protein kinase A | cAMP-dependent protein kinase alpha-catalytic subunit | cAMP-dependent protein kinase, alpha-catalytic subunit
Type:Enzyme Complex
Mol. Mass.:40627.77
Organism:Bos taurus (bovine)
Description:The PKA holoenzyme purified from bovine heart, exists as an inactive tetrameric complex, which consists of a regulatory dimer associated with two catalytic subunits. It requires cAMP to activate the enzymatic reaction.
Residue:351
Sequence:
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVML
VKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM15210
NameBDBM15210
Synonyms:CHEMBL148333 | H-8 | Lopac-M-9656 | N-(2-methylaminoethyl)isoquinoline-5-sulfonamide | N-[2-(methylamino)ethyl]isoquinoline-5-sulfonamide
TypeSmall organic molecule
Emp. Form.C12H15N3O2S
Mol. Mass.265.331
SMILESCNCCNS(=O)(=O)c1cccc2cnccc12
Structure
PKA-specific peptide substrate
Name:PKA-specific peptide substrate
Synonyms:PKAtide
Type:Peptide
Mol. Mass.:1019.14
Organism:n/a
Description:n/a
Residue:9
Sequence:
GRTGRRNSI