Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase Chk1
LigandBDBM15249
Substrate/CompetitorCdc25C peptide substrate
Meas. Tech.Chk1 Enzymatic Assay
pH7.4±n/a
Temperature295.15±n/a K
IC50 6±n/a nM
Citation Tao, ZFWang, LStewart, KDChen, ZGu, WBui, MHMerta, PZhang, HKovar, PJohnson, EPark, CJudge, RRosenberg, SSowin, TLin, NH Structure-based design, synthesis, and biological evaluation of potent and selective macrocyclic checkpoint kinase 1 inhibitors. J Med Chem50:1514-27 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Serine/threonine-protein kinase Chk1
Name:Serine/threonine-protein kinase Chk1/2
Synonyms:CHK1 checkpoint homolog | Checkpoint kinase-1 (CHK1) | Serine/threonine-protein kinase Chk1
Type:Enzyme Catalytic Domain
Mol. Mass.:54443.02
Organism:Homo sapiens (Human)
Description:gi_166295192
Residue:476
Sequence:
MAVPFVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKEICINK
MLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVY
LHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLK
RREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLA
LLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDF
SPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCPDHMLLNSQLL
GTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRR
NNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKIWLPAT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM15249
NameBDBM15249
Synonyms:7-chloro-3-oxo-11,16-dioxa-2,4,19,21-tetraazatricyclo[15.3.1.0^{5,10}]henicosa-1(20),5(10),6,8,17(21),18-hexaene-18-carbonitrile | CHEMBL375097 | macrocyclic inhibitor 5c
TypeSmall organic molecule
Emp. Form.C16H14ClN5O3
Mol. Mass.359.767
SMILESClc1ccc2OCCCCOc3nc(NC(=O)Nc2c1)cnc3C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
Cdc25C peptide substrate
Name:Cdc25C peptide substrate
Synonyms:n/a
Type:Peptide
Mol. Mass.:2519.88
Organism:n/a
Description:Cdc25c peptide substrate contained a sequence of amino acid residues 204-225 of human phosphatase Cdc25C.
Residue:22
Sequence:
AKVSRSGLYRSPSMPENLNRPR