Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMitogen-activated protein kinase 14
LigandBDBM15453
Substrate/Competitorbiotinylated GST-ATF2
Meas. Tech.Enzyme Inhibition Assay
IC50>1000±n/a nM
Citation Dombroski, MALetavic, MAMcClure, KFBarberia, JTCarty, TJCortina, SRCsiki, CDipesa, AJElliott, NCGabel, CAJordan, CKLabasi, JMMartin, WHPeese, KMStock, IASvensson, LSweeney, FJYu, CH Benzimidazolone p38 inhibitors. Bioorg Med Chem Lett14:919-23 (2004) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Mitogen-activated protein kinase 14
Name:p38 MAP kinase alpha/beta
Synonyms:CSAID-binding protein | CSBP | Cytokine suppressive anti-inflammatory drug-binding protein | MAP kinase 14 | MAP kinase MXI2 | MAP kinase p38 alpha | MAPK 14 | MAX-interacting protein 2 | Mitogen-activated protein kinase p38 alpha | SAPK2a | Stress-activated protein kinase 2a
Type:Serine/threonine-protein kinase
Mol. Mass.:41286.76
Organism:Homo sapiens (Human)
Description:Q16539
Residue:360
Sequence:
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM15453
NameBDBM15453
Synonyms:1,3-diethyl-5-[1-(4-fluoro-3-methylphenyl)-1H-1,2,3,4-tetrazol-5-yl]-2,3-dihydro-1H-1,3-benzodiazol-2-one | benzimidazolone 21
TypeSmall organic molecule
Emp. Form.C19H19FN6O
Mol. Mass.366.3922
SMILESCCn1c2ccc(cc2n(CC)c1=O)-c1nnnn1-c1ccc(F)c(C)c1
Structure
biotinylated GST-ATF2
Name:biotinylated GST-ATF2
Synonyms:ATF-2-GST | ATF2 | Activating transcription factor 2 | Activating transcription factor 2-GST fusion | GST-ATF2 | biotinylated ATF2 substrate | biotinylated Activating transcription factor 2 | biotinylated activating transcription factor 2
Type:Other Protein Type
Mol. Mass.:12237.77
Organism:Homo sapiens (Human)
Description:n/a
Residue:109
Sequence:
MSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVADQTPTPTRFLKN
CEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff: