Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldehyde reductase
LigandBDBM16314
Substrate/CompetitorBDBM16241
Meas. Tech.Enzyme Inhibition Assay
IC50 1940±n/a nM
Citation Van Zandt, MCJones, MLGunn, DEGeraci, LSJones, JHSawicki, DRSredy, JJacot, JLDicioccio, ATPetrova, TMitschler, APodjarny, AD Discovery of 3-[(4,5,7-trifluorobenzothiazol-2-yl)methyl]indole-N-acetic acid (lidorestat) and congeners as highly potent and selective inhibitors of aldose reductase for treatment of chronic diabetic complications. J Med Chem48:3141-52 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Aldehyde reductase
Name:Aldehyde reductase
Synonyms:Alcohol dehydrogenase [NADP+] | Aldehyde Reductase (ALR1) | Aldo-keto reductase family 1 member A1
Type:Enzyme
Mol. Mass.:36574.11
Organism:Homo sapiens (Human)
Description:n/a
Residue:325
Sequence:
MAASCVLLHTGQKMPLIGLGTWKSEPGQVKAAVKYALSVGYRHIDCAAIYGNEPEIGEAL
KEDVGPGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFER
GDNPFPKNADGTICYDSTHYKETWKALEALVAKGLVQALGLSNFNSRQIDDILSVASVRP
AVLQVECHPYLAQNELIAHCQARGLEVTAYSPLGSSDRAWRDPDEPVLLEEPVVLALAEK
YGRSPAQILLRWQVQRKVICIPKSITPSRILQNIKVFDFTFSPEEMKQLNALNKNWRYIV
PMLTVDGKRVPRDAGHPLYPFNDPY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM16314
NameBDBM16314
Synonyms:2-{[6-methoxy-5-(trifluoromethyl)naphthalen-1-yl]-N-methylmethanethioamido}acetic acid | Alredase | CHEMBL436 | N-{[6-methoxy-5-(trifluoromethyl)naphthalen-1-yl]carbonothioyl}-N-methylglycine | Tolrestat
TypeSmall organic molecule
Emp. Form.C16H14F3NO3S
Mol. Mass.357.347
SMILESCOc1ccc2c(cccc2c1C(F)(F)F)C(=S)N(C)CC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM16241
NameBDBM16241
Synonyms:2,3-dihydroxypropanal | D,L-glyceraldehyde | Glycerinformal | Glycerose
TypeSmall organic molecule
Emp. Form.C3H6O3
Mol. Mass.90.0779
SMILESOCC(O)C=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: