Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase Chk1
LigandBDBM16590
Substrate/CompetitorChktide
Meas. Tech.Chk1 Ki determination
pH7.5±n/a
Temperature303.15±n/a K
Ki 8580±3060 nM
Citation Foloppe, NFisher, LMFrancis, GHowes, RKierstan, PPotter, A Identification of a buried pocket for potent and selective inhibition of Chk1: prediction and verification. Bioorg Med Chem14:1792-804 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Serine/threonine-protein kinase Chk1
Name:Serine/threonine-protein kinase Chk1
Synonyms:CHK1 checkpoint homolog | Checkpoint kinase-1 (CHK1)
Type:Enzyme Catalytic Domain
Mol. Mass.:54443.02
Organism:Homo sapiens (Human)
Description:gi_166295192
Residue:476
Sequence:
MAVPFVEDWDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMKRAVDCPENIKKEICINK
MLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFHQLMAGVVY
LHGIGITHRDIKPENLLLDERDNLKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLK
RREFHAEPVDVWSCGIVLTAMLAGELPWDQPSDSCQEYSDWKEKKTYLNPWKKIDSAPLA
LLHKILVENPSARITIPDIKKDRWYNKPLKKGAKRPRVTSGGVSESPSGFSKHIQSNLDF
SPVNSASSEENVKYSSSQPEPRTGLSLWDTSPSYIDKLVQGISFSQPTCPDHMLLNSQLL
GTPGSSQNPWQRLVKRMTRFFTKLDADKSYQCLKETCEKLGYQWKKSCMNQVTISTTDRR
NNKLIFKVNLLEMDDKILVDFRLSKGDGLEFKRHFLKIKGKLIDIVSSQKIWLPAT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM16590
NameBDBM16590
Synonyms:2-(1H-indazol-3-yl)-1H-1,3-benzodiazole | 3-(1H-benzimidazol-2-yl)-1H-indazole | CHEMBL383990 | Indazole Compound 2
TypeSmall organic molecule
Emp. Form.C14H10N4
Mol. Mass.234.256
SMILESc1ccc2[nH]c(nc2c1)-c1n[nH]c2ccccc12
Structure
Chktide
Name:Chktide
Synonyms:n/a
Type:Peptide
Mol. Mass.:2707.16
Organism:n/a
Description:n/a
Residue:23
Sequence:
KKKVSRSGLYRSPSMPENLNRPR