Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target17-beta-Hydroxysteroid Dehydrogenase 5 (17-beta-HSD5, AKR1C3)
LigandBDBM17636
Substrate/CompetitorBDBM17637
Meas. Tech.3alpha-Androstanediol Oxidation Inhibition Assay
pH7±n/a
Temperature303.15±n/a K
Ki 140±10 nM
Km32000±2000 nM
CommentsCompetitive inhibition.
Citation Lovering, ALRide, JPBunce, CMDesmond, JCCummings, SMWhite, SA Crystal structures of prostaglandin D(2) 11-ketoreductase (AKR1C3) in complex with the nonsteroidal anti-inflammatory drugs flufenamic acid and indomethacin. Cancer Res64:1802-10 (2004) [PubMed]
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
17-beta-Hydroxysteroid Dehydrogenase 5 (17-beta-HSD5, AKR1C3)
Name:Aldo-keto-reductase family 1 member C3
Synonyms:3-alpha-HSD type 2 | Aldo-keto reductase family 1 member C3 | Aldo-keto reductase family 1 member C3 (AK1C3) | Aldo-keto reductase family 1 member C3 (AK1C3a) | Aldo-keto reductase family 1 member C3 (AKR1C3) | Dihydrodiol dehydrogenase 3 | Dihydrodiol dehydrogenase type I | Estradiol 17-beta-dehydrogenase | Prostaglandin F synthase | Testosterone 17-beta-dehydrogenase 5 | Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase
Type:Enzyme
Mol. Mass.:36859.86
Organism:Homo sapiens (human)
Description:P42330
Residue:323
Sequence:
MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPM
SLKPGEELSPTDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKP
GLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLD
RNLHYFNSDSFASHPNYPYSDEY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM17636
NameBDBM17636
Synonyms:2-{[3-(trifluoromethyl)phenyl]amino}benzoic acid | Arlef | CHEMBL23588 | Flufenamic acid | Nichisedan | US9271961, Flufenamic Acid
TypeSmall organic molecule
Emp. Form.C14H10F3NO2
Mol. Mass.281.2299
SMILESOC(=O)c1ccccc1Nc1cccc(c1)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM17637
NameBDBM17637
Synonyms:(2S,5R,7S,14S,15S)-2,15-dimethyltetracyclo[8.7.0.0^{2,7}.0^{11,15}]heptadecane-5,14-diol | 3alpha-Androstanediol
TypeSteroid
Emp. Form.C19H32O2
Mol. Mass.292.4562
SMILES[H][C@@]1(O)CC[C@]2(C)C3CC[C@]4(C)[C@@H](O)CCC4C3CC[C@@]2([H])C1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: