Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThyroid Hormone Receptor (TR-beta)
LigandBDBM18937
Substrate/CompetitorBDBM18860
Meas. Tech.TRalpha-Binding Assay.
IC50 7.7±n/a nM
Citation Hangeland, JJDoweyko, AMDejneka, TFriends, TJDevasthale, PMellström, KSandberg, JGrynfarb, MSack, JSEinspahr, HFärnegård, MHusman, BLjunggren, JKoehler, KSheppard, CMalm, JRyono, DE Thyroid receptor ligands. Part 2: Thyromimetics with improved selectivity for the thyroid hormone receptor beta. Bioorg Med Chem Lett14:3549-53 (2004) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Thyroid Hormone Receptor (TR-beta)
Name:Thyroid hormone receptor
Synonyms:Nuclear receptor subfamily 1 group A member 2 | Thyroid hormone receptor | Thyroid hormone receptor beta
Type:Receptor
Mol. Mass.:52793.62
Organism:Homo sapiens (Human)
Description:Recombinant hThR was obtained from nuclear extracts from SF9 cells infected with baculovirus vectors encoding for ThRbeta 1.
Residue:461
Sequence:
MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLKNEQSSPHLIQ
TTWTSSIFHLDHDDVNDQSVSSAQTFQTEEKKCKGYIPSYLDKDELCVVCGDKATGYHYR
CITCEGCKGFFRRTIQKNLHPSYSCKYEGKCVIDKVTRNQCQECRFKKCIYVGMATDLVL
DDSKRLAKRKLIEENREKRRREELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWK
QKRKFLPEDIGQAPIVNAPEGGKVDLEAFSHFTKIITPAITRVVDFAKKLPMFCELPCED
QIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSL
SSFNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPK
LLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM18937
NameBDBM18937
Synonyms:2-[3,5-dichloro-4-(3-cyclohexyl-4-hydroxyphenoxy)phenyl]acetic acid | 4-hydroxy thyromimetic, 9s
TypeSmall organic molecule
Emp. Form.C20H20Cl2O4
Mol. Mass.395.276
SMILESOC(=O)Cc1cc(Cl)c(Oc2ccc(O)c(c2)C2CCCCC2)c(Cl)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM18860
NameBDBM18860
Synonyms:(2R)-2-amino-3-[4-(4-hydroxy-3-iodophenoxy)-3,5-diiodophenyl]propanoic acid | (2S)-2-amino-3-[4-(4-hydroxy-3-iodophenoxy)-3,5-diiodophenyl]propanoic acid | 3,5,3'-triiodo-L-thyronine (T3) | CHEMBL1544 | Triiodothyronine | Triiodothyronine (T3) | [125I]T3 | liothyronine | triothyrone
TypeHormone
Emp. Form.C15H12I3NO4
Mol. Mass.650.9735
SMILESN[C@@H](Cc1cc(I)c(Oc2ccc(O)c(I)c2)c(I)c1)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: