Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCathepsin K
LigandBDBM19738
Substrate/CompetitorBDBM19485
Meas. Tech.Enzyme Inhibition Assay
pH7±n/a
Temperature295.15±n/a K
IC50 0.3±n/a nM
Km35000±n/a nM
Citation Altmann, EAichholz, RBetschart, CBuhl, TGreen, JIrie, OTeno, NLattmann, RTintelnot-Blomley, MMissbach, M 2-Cyano-pyrimidines: a new chemotype for inhibitors of the cysteine protease cathepsin K. J Med Chem50:591-4 (2007) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Cathepsin K
Name:Cathepsin K
Synonyms:CTSK | CTSO | CTSO2 | Cathepsin O | Cathepsin O2 | Cathepsin X
Type:Enzyme
Mol. Mass.:36975.68
Organism:Homo sapiens (Human)
Description:P43235
Residue:329
Sequence:
MWGLKVLLLPVVSFALYPEEILDTHWELWKKTHRKQYNNKVDEISRRLIWEKNLKYISIH
NLEASLGVHTYELAMNHLGDMTSEEVVQKMTGLKVPLSHSRSNDTLYIPEWEGRAPDSVD
YRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSENDGCGGG
YMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKALKRAVA
RVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWIIKNSWGE
NWGNKGYILMARNKNNACGIANLASFPKM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM19738
NameBDBM19738
Synonyms:2-Cyano-pyrimidine, 17c | 2-cyano-4-[(2,2-dimethylpropyl)amino]-N-{2-[4-(pyrrolidin-1-yl)phenyl]ethyl}pyrimidine-5-carboxamide
TypeSmall organic molecule
Emp. Form.C23H30N6O
Mol. Mass.406.5239
SMILESCC(C)(C)CNc1nc(ncc1C(=O)NCCc1ccc(cc1)N1CCCC1)C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM19485
NameBDBM19485
Synonyms:Cbz-Phe-Arg-AMC | Fluorogenic substrate | Z-Phe-Arg-AMC.HCl
Typen/a
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure