| Reaction Details |
| Report a problem with these data |
| Target | Cathepsin K |
| Ligand | Azepan-3-one compound 2 |
| Substrate/Competitor | Cbz-Phe-Arg-AMC |
| Meas. Tech. | Enzyme Inhibition Assay |
| pH | 5.5±n/a |
| Temperature | 295.15±n/a K |
| Ki | 0.0099±n/a nM |
| Citation | Yamashita, DS; Marquis, RW; Xie, R; Nidamarthy, SD; Oh, HJ; Jeong, JU; Erhard, KF; Ward, KW; Roethke, TJ; Smith, BR; Cheng, HY; Geng, X; Lin, F; Offen, PH; Wang, B; Nevins, N; Head, MS; Haltiwanger, RC; Narducci Sarjeant, AA; Liable-Sands, LM; Zhao, B; Smith, WW; Janson, CA; Gao, E; Tomaszek, T; McQueney, M; James, IE; Gress, CJ; Zembryki, DL; Lark, MW; Veber, DF Structure activity relationships of 5-, 6-, and 7-methyl-substituted azepan-3-one cathepsin K inhibitors.J Med Chem.49:1597-612(2006)[PubMed] |
| More Info. |
Get all data from this article
, Solution Info
, Assay Method
|
| Cathepsin K |
| Name | Cathepsin K |
| Synonyms | Cathepsin O | Cathepsin X | Cathepsin O2 | EC 3.4.22.38 |
| Type | Enzyme |
| Mol. Mass. | n/a |
| Organism | Homo sapiens (human) |
| Description | Recombinant human cathepsin K. |
| Residue | 215 |
| Sequence | APDSVDYRKKGYVTPVKNQGQCGSCWAFSSVGALEGQLKKKTGKLLNLSPQNLVDCVSEN
DGCGGGYMTNAFQYVQKNRGIDSEDAYPYVGQEESCMYNPTGKAAKCRGYREIPEGNEKA
LKRAVARVGPVSVAIDASLTSFQFYSKGVYYDESCNSDNLNHAVLAVGYGIQKGNKHWII
KNSWGENWGNKGYILMARNKNNACGIANLASFPKM
| |
|
| Azepan-3-one compound 2 |
| Name | Azepan-3-one compound 2 |
| Synonyms: | (2S)-2-(1-benzofuran-2-ylformamido)-4-methyl-N-[(4S,5S)-5-methyl-3-oxo-1-(pyridine-2-sulfonyl)azepan-4-yl]pentanamide |
| Type | Small organic molecule |
| Emp. Form. | C27H32N4O6S |
| Mol. Mass. | 540.631 |
| SMILES | CC(C)C[C@H](NC(=O)c1cc2ccccc2o1)C(=O)N[C@H]1[C@@H](C)CCN(CC1=O)S(=O)(=O)c1ccccn1 |r| |
| Structure | |
| Cbz-Phe-Arg-AMC |
| Name | Cbz-Phe-Arg-AMC |
| Synonyms: | Fluorogenic substrate | Z-Phe-Arg-AMC.HCl |
| Type | n/a |
| Emp. Form. | n/a |
| Mol. Mass. | n/a |
| SMILES | n/a |
| Structure | |