Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLiver X Receptor alpha (LXR-alpha)
LigandBDBM20002
Substrate/CompetitorBDBM19993
Meas. Tech.LXR Binding Assay
pH7.4±n/a
Temperature277.15±n/a K
IC50 47±n/a nM
Citation Hu, BCollini, MUnwalla, RMiller, CSinghaus, RQuinet, ESavio, DHalpern, ABasso, MKeith, JClerin, VChen, LResmini, CLiu, QYFeingold, IHuselton, CAzam, FFarnegardh, MEnroth, CBonn, TGoos-Nilsson, AWilhelmsson, ANambi, PWrobel, J Discovery of phenyl acetic acid substituted quinolines as novel liver X receptor agonists for the treatment of atherosclerosis. J Med Chem49:6151-4 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Liver X Receptor alpha (LXR-alpha)
Name:Liver X Receptor alpha (LXR-alpha)
Synonyms:Nuclear orphan receptor LXR-alpha | Nuclear receptor subfamily 1 group H member 3 | Oxysterols receptor LXR-alpha
Type:Receptor
Mol. Mass.:28986.41
Organism:Homo sapiens (human)
Description:LXR alpha ligand binding domain (amino acid residues 197-447) with an N-terminal biotinylation tag expressed in E.coli, was used for the binding assays.
Residue:251
Sequence:
SSPPQILPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPMAPDPHSREARQQRFAH
FTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITFL
KDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAISIFSADRPNVQDQL
QVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLP
PLLSEIWDVHE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM20002
NameBDBM20002
Synonyms:2-{4-[({3-[3-benzyl-8-(trifluoromethyl)quinolin-4-yl]phenyl}methyl)amino]phenyl}acetic acid | CHEMBL216645 | Quinoline 17
TypeSmall organic molecule
Emp. Form.C32H25F3N2O2
Mol. Mass.526.5483
SMILESOC(=O)Cc1ccc(NCc2cccc(c2)-c2c(Cc3ccccc3)cnc3c(cccc23)C(F)(F)F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM19993
NameBDBM19993
Synonyms:CHEMBL62136 | N-[4-(1,1,1,3,3,3-hexafluoro-2-hydroxypropan-2-yl)phenyl]-N-(2,2,2-trifluoroethyl)benzenesulfonamide | T 0901317 | T0901317 | TO-901317 | [3H]T0901317
TypeSmall organic molecule
Emp. Form.C17H12F9NO3S
Mol. Mass.481.333
SMILESOC(c1ccc(cc1)N(CC(F)(F)F)S(=O)(=O)c1ccccc1)(C(F)(F)F)C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: