Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLiver X Receptor alpha (LXR-alpha)
LigandBDBM20022
Substrate/CompetitorBDBM19993
Meas. Tech.LXR Binding Assay
pH7.4±n/a
Temperature277.15±n/a K
IC50 33.6±n/a nM
Citation Hu, BJetter, JKaufman, DSinghaus, RBernotas, RUnwalla, RQuinet, ESavio, DHalpern, ABasso, MKeith, JClerin, VChen, LLiu, QYFeingold, IHuselton, CAzam, FGoos-Nilsson, AWilhelmsson, ANambi, PWrobel, J Further modification on phenyl acetic acid based quinolines as liver X receptor modulators. Bioorg Med Chem15:3321-33 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Liver X Receptor alpha (LXR-alpha)
Name:Liver X Receptor alpha (LXR-alpha)
Synonyms:Nuclear orphan receptor LXR-alpha | Nuclear receptor subfamily 1 group H member 3 | Oxysterols receptor LXR-alpha
Type:Receptor
Mol. Mass.:28986.41
Organism:Homo sapiens (human)
Description:LXR alpha ligand binding domain (amino acid residues 197-447) with an N-terminal biotinylation tag expressed in E.coli, was used for the binding assays.
Residue:251
Sequence:
SSPPQILPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPMAPDPHSREARQQRFAH
FTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITFL
KDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAISIFSADRPNVQDQL
QVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLP
PLLSEIWDVHE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM20022
BDBM19993
NameBDBM20022
Synonyms:2-{4-[({3-[3-benzoyl-8-(trifluoromethyl)quinolin-4-yl]phenyl}amino)methyl]phenyl}-2-hydroxyacetic acid | phenyl acetic acid based quinoline, 34
TypeSmall organic molecule
Emp. Form.C32H23F3N2O4
Mol. Mass.556.5312
SMILESOC(C(O)=O)c1ccc(CNc2cccc(c2)-c2c(cnc3c(cccc23)C(F)(F)F)C(=O)c2ccccc2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: