Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHeat shock protein HSP 90-beta
LigandBDBM15374
Substrate/CompetitorBDBM10852
Meas. Tech.Her-2 Degradation Assay
pH7.2±n/a
Temperature310.15±n/a K
EC50 40000±n/a nM
Citation Biamonte, MAShi, JHong, KHurst, DCZhang, LFan, JBusch, DJKarjian, PLMaldonado, AASensintaffar, JLYang, YCKamal, ALough, RELundgren, KBurrows, FJTimony, GABoehm, MFKasibhatla, SR Orally active purine-based inhibitors of the heat shock protein 90. J Med Chem49:817-28 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Heat shock protein HSP 90-beta
Name:Heat shock protein HSP 90-beta
Synonyms:HSP 84 | HSP 90 | HSP90B | Heat Shock Protein 90 (Hsp90) | Heat shock protein HSP 90 (Hsp90)
Type:Molecular Chaperone
Mol. Mass.:83229.45
Organism:Homo sapiens (Human)
Description:P08238
Residue:724
Sequence:
MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLT
DPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAG
ADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTK
VILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEE
DKDDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEE
YGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRV
FIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELA
EDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQ
KSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEG
LELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTA
NMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFE
TALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVAAEEPNAAVPDEIPPLEGDEDASRM
EEVD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM15374
NameBDBM15374
Synonyms:9-butyl-8-(3,4,5-trimethoxybenzyl)-9H-purin-6-amine | 9-butyl-8-[(3,4,5-trimethoxyphenyl)methyl]-9H-purin-6-amine | CHEMBL113690 | PU3 | Purine-Based Inhibitor 1
TypeSmall organic molecule
Emp. Form.C19H25N5O3
Mol. Mass.371.4335
SMILESCCCCn1c(Cc2cc(OC)c(OC)c(OC)c2)nc2c(N)ncnc12
Structure
BDBM10852