Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKappa-type opioid receptor
LigandBDBM21128
Substrate/CompetitorBDBM21130
Meas. Tech.Radioligand Labeled Binding Assay
pH7.4±n/a
Temperature298.15±n/a K
Ki 3870±185 nM
Citation Mollica, AGuardiani, GDavis, PMa, SWPorreca, FLai, JMannina, LSobolev, APHruby, VJ Synthesis of Stable and Potent delta/mu Opioid Peptides: Analogues of H-Tyr-c[d-Cys-Gly-Phe-d-Cys]-OH by Ring-Closing Metathesis. J Med Chem50:3138-3142 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Kappa-type opioid receptor
Name:Kappa-type opioid receptor
Synonyms:Kappa Opioid Receptor | OPIATE Kappa | Opiate Kappa 1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:42744.99
Organism:Cavia porcellus (domestic guinea pig)
Description:P41144
Residue:380
Sequence:
MGRRRQGPAQPASELPARNACLLPNGSAWLPGWAEPDGNGSAGPQDEQLEPAHISPAIPV
IITAVYSVVFVVGLVGNSLVMFVIIRYTKMKTATNIYIFNLALADALVTTTMPFQSTVYL
MNSWPFGDVLCKIVISIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPLKAKIINI
CIWLLSSSVGISAIILGGTKVREDVDIIECSLQFPDDDYSWWDLFMKICVFVFAFVIPVL
IIIVCYTLMILRLKSVRLLSGSREKDRNLRRITRLVLVVVAVFIICWTPIHIFILVEALG
STSHSTAALSSYYFCIALGYTNSSLNPILYAFLDENFKRCFRDFCFPIKMRMERQSTSRV
RNTVQDPAYMRNVDGVNKPV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21128
NameBDBM21128
Synonyms:(2R)-2-[(2S)-2-{2-[(2R)-2-[(2S)-2-amino-3-(4-hydroxyphenyl)propanamido]pent-4-enamido]acetamido}-3-phenylpropanamido]pent-4-enoic acid | [2-D-allylglycine, 5-D-allylglycine]-enkephalin | lDADAE (13) | linear H-Tyr-D-AllylGly-Gly-Phe-D-Allylgly-OH
TypePeptide
Emp. Form.C30H37N5O7
Mol. Mass.579.6441
SMILESN[C@@H](Cc1ccc(O)cc1)C(=O)N[C@H](CC=C)C(=O)NCC(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@H](CC=C)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM21130
NameBDBM21130
Synonyms:N-methyl-2-phenyl-N-[(5R,7S,8S)-7-(pyrrolidin-1-yl)-1-oxaspiro[4.5]decan-8-yl]acetamide | N-methyl-N-(7-(1-pyrrolidinyl)-1-oxaspiro(4,5)dec-8-yl)benzeneacetamide | U-69593 | U69,593 | [3H]U69593
Typeradiolabeled ligand
Emp. Form.C22H32N2O2
Mol. Mass.356.5017
SMILESCN([C@H]1CC[C@@]2(CCCO2)C[C@@H]1N1CCCC1)C(=O)Cc1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: