Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A2a
LigandBDBM21190
Substrate/CompetitorBDBM21190
Meas. Tech.Receptor Binding Assay
Kd.22±n/a nM
Citation Slee, DHChen, YZhang, XMoorjani, MLanier, MCLin, ERueter, JKWilliams, JPLechner, SMMarkison, SMalany, SSantos, MGross, RSJalali, KSai, YZuo, ZYang, CCastro-Palomino, JCCrespo, MIPrat, MGual, SDíaz, JLSaunders, J 2-Amino-N-pyrimidin-4-ylacetamides as A2A Receptor Antagonists: 1. Structure-Activity Relationships and Optimization of Heterocyclic Substituents. J Med Chem51:1719-29 (2008) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Adenosine receptor A2a
Name:Adenosine receptor
Synonyms:A2A adenosine receptor (hA2A) | ADENOSINE A2 | ADENOSINE A2a | ADORA2 | ADORA2A | Adenosine A2A receptor (A2AAR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:44716.46
Organism:Homo sapiens (human)
Description:Expressed in CHO cells
Residue:412
Sequence:
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI
PFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR
AKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYF
NFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFR
KIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNG
YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21190
BDBM21190
NameBDBM21190
Synonyms:4-(2-{[5-amino-2-(furan-2-yl)-[1,2,4]triazolo[1,5-a][1,3,5]triazin-7-yl]amino}ethyl)phenol | CHEMBL113142 | ZM 241385 | ZM241385 | [3H]-ZM241385
TypeSmall organic molecule
Emp. Form.C16H15N7O2
Mol. Mass.337.336
SMILESNc1nc(NCCc2ccc(O)cc2)nc2nc(nn12)-c1ccco1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: