Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptors; A1 & A2a
LigandBDBM21222
Substrate/CompetitorBDBM21241
Meas. Tech.Human A2A Adenosine Receptor Binding Assay
pH7.4±n/a
Temperature298.15±n/a K
Comments29% inhibition @10 uM.
Citation Cosimelli, BGreco, GEhlardo, MNovellino, EDa Settimo, FTaliani, SLa Motta, CBellandi, MTuccinardi, TMartinelli, ACiampi, OTrincavelli, MLMartini, C Derivatives of 4-Amino-6-hydroxy-2-mercaptopyrimidine as Novel, Potent, and Selective A3 Adenosine Receptor Antagonists. J Med Chem51:1764-70 (2008) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Adenosine receptors; A1 & A2a
Name:Adenosine receptors; A1 & A2a
Synonyms:A2A adenosine receptor (hA2A) | ADENOSINE A2 | ADENOSINE A2a | ADORA2A | Adenosine A2A receptor (A2AAR)
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:44716.46
Organism:Homo sapiens (human)
Description:Expressed in CHO cells
Residue:412
Sequence:
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI
PFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR
AKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYF
NFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFR
KIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNG
YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21222
NameBDBM21222
Synonyms:2-mercaptopyrimidine analogue, 5a | N-[6-methoxy-2-(methylsulfanyl)pyrimidin-4-yl]acetamide
TypeSmall organic molecule
Emp. Form.C8H11N3O2S
Mol. Mass.213.257
SMILESCOc1cc(NC(C)=O)nc(SC)n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM21241
NameBDBM21241
Synonyms:Adenosine, N6-Ethyl-carboxamido | Adenosine-5 -(N-ethylcarboxamide) | N-Ethylcarboxamidoadenosine | [3H]NECA
Typeradiolabeled ligand
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure