Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin G/H synthase (cyclooxygenase)
LigandBDBM22354
Substrate/CompetitorBDBM22319
Meas. Tech.COX Inhibitor Screening Assay
pH8±n/a
Temperature310.15±n/a K
IC50 3500±n/a nM
Citation Rao, PNChen, QHKnaus, EE Synthesis and structure-activity relationship studies of 1,3-diarylprop-2-yn-1-ones: dual inhibitors of cyclooxygenases and lipoxygenases. J Med Chem49:1668-83 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Prostaglandin G/H synthase (cyclooxygenase)
Name:Prostaglandin G/H synthase (cyclooxygenase)
Synonyms:Cyclooxygenase-1 | Cyclooxygenase-1 (COX-1)
Type:Protein
Mol. Mass.:68868.60
Organism:Ovis aries (Sheep)
Description:n/a
Residue:600
Sequence:
MSRQSISLRFPLLLLLLSPSPVFSADPGAPAPVNPCCYYPCQHQGICVRFGLDRYQCDCT
RTGYSGPNCTIPEIWTWLRTTLRPSPSFIHFLLTHGRWLWDFVNATFIRDTLMRLVLTVR
SNLIPSPPTYNIAHDYISWESFSNVSYYTRILPSVPRDCPTPMDTKGKKQLPDAEFLSRR
FLLRRKFIPDPQSTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLER
QYQLRLFKDGKLKYQMLNGEVYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLML
YATIWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLK
FDPELLFGAQFQYRNRIAMEFNQLYHWHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVE
ALVDAFSRQPAGRIGGGRNIDHHILHVAVDVIKESRVLRLQPFNEYRKRFGMKPYTSFQE
LTGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEMGAPFSLKGLLGNPIC
SPEYWKASTFGGEVGFNLVKTATLKKLVCLNTKTCPYVSFHVPDPRQEDRPGVERPPTEL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22354
NameBDBM22354
Synonyms:1,3-Diarylprop-2-yn-1-one, 13k | 1-(4-hydroxyphenyl)-3-(4-methanesulfonylphenyl)prop-2-yn-1-one | CHEMBL194297
TypeSmall organic molecule
Emp. Form.C16H12O4S
Mol. Mass.300.329
SMILESCS(=O)(=O)c1ccc(cc1)C#CC(=O)c1ccc(O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM22319
NameBDBM22319
Synonyms:(5Z,8Z,11Z,14Z)-icosa-5,8,11,14-tetraenoic acid | Arachidonic acid | Arachidonic acid (AA) | CHEMBL15594 | [1-14C]Arachidonic acid
TypeUnsaturated fatty acid
Emp. Form.C20H32O2
Mol. Mass.304.4669
SMILESCCCCC\C=C/C\C=C/C\C=C/C\C=C/CCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: