Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target5-Lipoxygenase
LigandBDBM22354
Substrate/CompetitorBDBM22231
Meas. Tech.COX Inhibitor Screening Assay
IC50 300±n/a nM
Citation Rao, PNChen, QHKnaus, EE Synthesis and structure-activity relationship studies of 1,3-diarylprop-2-yn-1-ones: dual inhibitors of cyclooxygenases and lipoxygenases. J Med Chem49:1668-83 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
5-Lipoxygenase
Name:5-Lipoxygenase
Synonyms:5-Lipoxygenase (5-LO)
Type:Enzyme
Mol. Mass.:97294.59
Organism:Solanum tuberosum (potato)
Description:n/a
Residue:864
Sequence:
MNIGQIMGGRELFGGHDDSKKVKGTVVMMKKNALDFTDLAGSLTDIAFDVLGQKVSFQLI
SSVQGDPTNGLQGKHSNPAYLENSLFTLTPLTAGSETAFGVTFDWNEEFGVPGAFIIKNT
HINEFFLKSLTLEDVPNHGKVHFDCNSWVYPSFRYKSDRIFFANQPYLPSKTPELLRKYR
ENELLTLRGDGTGKREAWDRIYDYDIYNDLGNPDQGKENVRTTLGGSAEYPYPRRGRTGR
PPTRTDPKSESRIPLLLSLDIYVPRDERFGHLKMSDFLTYALKSIVQFILPELHALFDGT
PNEFDSFEDVLRLYEGGIKLPQGPLFKALTAAIPLEMIKELLRTDGEGILRFPTPLVIKD
SKTAWRTDEEFAREMLAGVNPIIISRLQEFPPKSKLDPEAYGNQNSTITAEHIEDKLDGL
TVDEAMNNNKLFILNHHDLLIPYLRRINTTITKSYASRTLLFLQDNGSLKPLAIELSLPH
PDGDQFGVTSKVYTPSDQGVESSIWQLAKAYVAVNDAGVHQLISHWLNTHAVIEPFVIAT
NRQLSVLHPIHKLLYPHFRDTMNINASARQILINAGGVLESTVFQSKFALEMSAVVYKDW
VFPDQALPADLVKRGVAVEDSSSPHGVRLLIEDYPYAVDGLEIWSAIKSWVTDYCSFYYG
SDEEILKDNELQAWWKELREVGHGDKKNEPWWPEMETPQELIDSCTTIIWIASALHAAVN
FGQYPYAGYLPNRPTVSRRFMPEPGTPEYEELKKNPDKAFLKTITAQLQTLLGVSLVEIL
SRHTTDEIYLGQRESPEWTKDKEPLAAFDKFGKKLTDIEKQIIQRNGDNILTNRSGPVNA
PYTLLFPTSEGGLTGKGIPNSVSI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22354
NameBDBM22354
Synonyms:1,3-Diarylprop-2-yn-1-one, 13k | 1-(4-hydroxyphenyl)-3-(4-methanesulfonylphenyl)prop-2-yn-1-one | CHEMBL194297
TypeSmall organic molecule
Emp. Form.C16H12O4S
Mol. Mass.300.329
SMILESCS(=O)(=O)c1ccc(cc1)C#CC(=O)c1ccc(O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM22231
NameBDBM22231
Synonyms:(9Z,12Z)-octadeca-9,12-dienoic acid | CHEMBL267476 | Linoleic Acid | Linoleic acid (LA)
TypeUnsaturated fatty acid
Emp. Form.C18H32O2
Mol. Mass.280.4455
SMILESCCCCC\C=C/C\C=C/CCCCCCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: