Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLipoxygenase-1
LigandBDBM22348
Substrate/CompetitorBDBM22231
Meas. Tech.COX Inhibitor Screening Assay
IC50 360±n/a nM
Citation Rao, PNChen, QHKnaus, EE Synthesis and structure-activity relationship studies of 1,3-diarylprop-2-yn-1-ones: dual inhibitors of cyclooxygenases and lipoxygenases. J Med Chem49:1668-83 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Lipoxygenase-1
Name:Seed lipoxygenase-1
Synonyms:15-LOX | 15-Lipo-oxygenase (15-LO) | 15-lipo-oxygenase (SLO) | Arachidonic Acid 15- Lipoxygenase | L-1 | Lipoxygenase (LOX) | Lipoxygenase (SLO) | Seed lipoxygenase-1
Type:Enzyme
Mol. Mass.:94365.66
Organism:Glycine max (soybean)
Description:n/a
Residue:839
Sequence:
MFSAGHKIKGTVVLMPKNELEVNPDGSAVDNLNAFLGRSVSLQLISATKADAHGKGKVGK
DTFLEGINTSLPTLGAGESAFNIHFEWDGSMGIPGAFYIKNYMQVEFFLKSLTLEAISNQ
GTIRFVCNSWVYNTKLYKSVRIFFANHTYVPSETPAPLVSYREEELKSLRGNGTGERKEY
DRIYDYDVYNDLGNPDKSEKLARPVLGGSSTFPYPRRGRTGRGPTVTDPNTEKQGEVFYV
PRDENLGHLKSKDALEIGTKSLSQIVQPAFESAFDLKSTPIEFHSFQDVHDLYEGGIKLP
RDVISTIIPLPVIKELYRTDGQHILKFPQPHVVQVSQSAWMTDEEFAREMIAGVNPCVIR
GLEEFPPKSNLDPAIYGDQSSKITADSLDLDGYTMDEALGSRRLFMLDYHDIFMPYVRQI
NQLNSAKTYATRTILFLREDGTLKPVAIELSLPHSAGDLSAAVSQVVLPAKEGVESTIWL
LAKAYVIVNDSCYHQLMSHWLNTHAAMEPFVIATHRHLSVLHPIYKLLTPHYRNNMNINA
LARQSLINANGIIETTFLPSKYSVEMSSAVYKNWVFTDQALPADLIKRGVAIKDPSTPHG
VRLLIEDYPYAADGLEIWAAIKTWVQEYVPLYYARDDDVKNDSELQHWWKEAVEKGHGDL
KDKPWWPKLQTLEDLVEVCLIIIWIASALHAAVNFGQYPYGGLIMNRPTASRRLLPEKGT
PEYEEMINNHEKAYLRTITSKLPTLISLSVIEILSTHASDEVYLGQRDNPHWTSDSKALQ
AFQKFGNKLKEIEEKLVRRNNDPSLQGNRLGPVQLPYTLLYPSSEEGLTFRGIPNSISI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22348
NameBDBM22348
Synonyms:1,3-Diarylprop-2-yn-1-one, 13e | 3-(4-methanesulfonylphenyl)-1-[4-(propan-2-yl)phenyl]prop-2-yn-1-one
TypeSmall organic molecule
Emp. Form.C19H18O3S
Mol. Mass.326.409
SMILESCC(C)c1ccc(cc1)C(=O)C#Cc1ccc(cc1)S(C)(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM22231
NameBDBM22231
Synonyms:(9Z,12Z)-octadeca-9,12-dienoic acid | CHEMBL267476 | Linoleic Acid | Linoleic acid (LA)
TypeUnsaturated fatty acid
Emp. Form.C18H32O2
Mol. Mass.280.4455
SMILESCCCCC\C=C/C\C=C/CCCCCCCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: