Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEstrogen-Related Receptor, gamma
LigandBDBM20608
Substrate/CompetitorBDBM20608
Meas. Tech.Radioligand Displacement Assay
pH7.4±n/a
Temperature295.15±n/a K
IC50 13±n/a nM
Citation Chao, EYCollins, JLGaillard, SMiller, ABWang, LOrband-Miller, LANolte, RTMcDonnell, DPWillson, TMZuercher, WJ Structure-guided synthesis of tamoxifen analogs with improved selectivity for the orphan ERRgamma. Bioorg Med Chem Lett16:821-4 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Estrogen-Related Receptor, gamma
Name:Estrogen-related receptor gamma
Synonyms:ERR gamma-2 | Estrogen receptor-related protein 3 | Nuclear receptor subfamily 3 group B member 3
Type:PROTEIN
Mol. Mass.:51305.00
Organism:Homo sapiens (Human)
Description:ChEMBL_1501351
Residue:458
Sequence:
MDSVELCLPESFSLHYEEELLCRMSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGG
SSDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYML
NSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSC
QACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSH
LLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSL
LQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMK
LEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMT
LPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM20608
NameBDBM20608
Synonyms:4-Hydroxytamoxifen | 4-Hydroxytamoxifen (9) | 4-[(1Z)-1-{4-[2-(dimethylamino)ethoxy]phenyl}-2-phenylbut-1-en-1-yl]phenol | AFIMOXIFENE | CHEMBL489 | [3H]4-OHT | cid_449459
TypeSmall organic molecule
Emp. Form.C26H29NO2
Mol. Mass.387.514
SMILESCC\C(=C(/c1ccc(O)cc1)c1ccc(OCCN(C)C)cc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM20608
NameBDBM20608
Synonyms:4-Hydroxytamoxifen | 4-Hydroxytamoxifen (9) | 4-[(1Z)-1-{4-[2-(dimethylamino)ethoxy]phenyl}-2-phenylbut-1-en-1-yl]phenol | AFIMOXIFENE | CHEMBL489 | [3H]4-OHT | cid_449459
TypeSmall organic molecule
Emp. Form.C26H29NO2
Mol. Mass.387.514
SMILESCC\C(=C(/c1ccc(O)cc1)c1ccc(OCCN(C)C)cc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: