Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEstrogen-Related Receptor, gamma
LigandBDBM20608
Substrate/CompetitorBiotinylated RIP140 peptide
Meas. Tech.ERRgamma FRET Assay
pH7±n/a
Temperature295.15±n/a K
EC50 15±n/a nM
Citation Zuercher, WJGaillard, SOrband-Miller, LAChao, EYShearer, BGJones, DGMiller, ABCollins, JLMcDonnell, DPWillson, TM Identification and structure-activity relationship of phenolic acyl hydrazones as selective agonists for the estrogen-related orphan nuclear receptors ERRbeta and ERRgamma. J Med Chem48:3107-9 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Estrogen-Related Receptor, gamma
Name:Estrogen-related receptor gamma
Synonyms:ERR gamma-2 | Estrogen receptor-related protein 3 | Nuclear receptor subfamily 3 group B member 3
Type:PROTEIN
Mol. Mass.:51305.00
Organism:Homo sapiens (Human)
Description:ChEMBL_1501351
Residue:458
Sequence:
MDSVELCLPESFSLHYEEELLCRMSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGG
SSDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYML
NSMPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSC
QACRFMKCLKVGMLKEGVRLDRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSH
LLVAEPEKIYAMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSL
LQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMK
LEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQDYEAGQHMEDPRRAGKMLMT
LPLLRQTSTKAVQHFYNIKLEGKVPMHKLFLEMLEAKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM20608
NameBDBM20608
Synonyms:4-Hydroxytamoxifen | 4-Hydroxytamoxifen (9) | 4-[(1Z)-1-{4-[2-(dimethylamino)ethoxy]phenyl}-2-phenylbut-1-en-1-yl]phenol | AFIMOXIFENE | CHEMBL489 | [3H]4-OHT | cid_449459
TypeSmall organic molecule
Emp. Form.C26H29NO2
Mol. Mass.387.514
SMILESCC\C(=C(/c1ccc(O)cc1)c1ccc(OCCN(C)C)cc1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
Biotinylated RIP140 peptide
Name:Biotinylated RIP140 peptide
Synonyms:Nuclear factor RIP140, 366-390 | Receptor-interacting protein 140 derived peptide
Type:Peptide
Mol. Mass.:2831.78
Organism:n/a
Description:n/a
Residue:25
Sequence:
LERNNIKQAANNSLLLHLLKSQTIP