Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarboxylesterase 1
LigandBDBM22728
Substrate/CompetitorBDBM22723
Meas. Tech.Enzyme Inhibition Assay
Ki>100000±n/a nM
Citation Wadkins, RMHyatt, JLWei, XYoon, KJWierdl, MEdwards, CCMorton, CLObenauer, JCDamodaran, KBeroza, PDanks, MKPotter, PM Identification and characterization of novel benzil (diphenylethane-1,2-dione) analogues as inhibitors of mammalian carboxylesterases. J Med Chem48:2906-15 (2005) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Carboxylesterase 1
Name:Carboxylesterase 1
Synonyms:liver carboxylesterase 1 | rCE
Type:Enzyme
Mol. Mass.:62292
Organism:Oryctolagus cuniculus (rabbit)
Description:n/a
Residue:565
Sequence:
MWLCALALASLAACTAWGHPSAPPVVDTVHGKVLGKFVSLEGFAQPVAVFLGVPFAKPPL
GSLRFAPPQPAESWSHVKNTTSYPPMCSQDAVSGHMLSELFTNRKENIPLKFSEDCLYLN
IYTPADLTKRGRLPVMVWIHGGGLMVGGASTYDGLALSAHENVVVVTIQYRLGIWGFFST
GDEHSRGNWGHLDQVAALRWVQDNIANFGGDPGSVTIFGESAGGQSVSILLLSPLTKNLF
HRAISESGVALLSSLFRKNTKSLAEKIAIEAGCKTTTSAVMVHCLRQKTEEELMEVTLKM
KFMALDLVGDPKENTAFLTTVIDGVLLPKAPAEILAEKKYNMLPYMVGINQQEFGWIIPM
QMLGYPLSEGKLDQKTATELLWKSYPIVNVSKELTPVATEKYLGGTDDPVKKKDLFLDML
ADLLFGVPSVNVARHHRDAGAPTYMYEYRYRPSFSSDMRPKTVIGDHGDEIFSVLGAPFL
KEGATEEEIKLSKMVMKYWANFARNGNPNGEGLPQWPAYDYKEGYLQIGATTQAAQKLKD
KEVAFWTELWAKEAARPRETEHIEL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22728
NameBDBM22728
Synonyms:2-hydroxy-1,2-diphenylethan-1-one | Benzoin | CHEMBL190677
TypeSmall organic molecule
Emp. Form.C14H12O2
Mol. Mass.212.2439
SMILESOC(C(=O)c1ccccc1)c1ccccc1
Structure
BDBM22723
NameBDBM22723
Synonyms:2-nitrophenyl acetate | Nitrophenyl Acetate | o-NPA | o-nitrophenyl acetate
TypeSmall organic molecule
Emp. Form.C8H7NO4
Mol. Mass.181.1455
SMILESCC(=O)Oc1ccccc1[N+]([O-])=O
Structure