Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcyl-CoA: cholesterol acyltransferase (ACAT)
LigandBDBM22858
Substrate/CompetitorBDBM22723
Meas. Tech.Enzyme Inhibition Assay
Ki 15.9±n/a nM
Citation Hyatt, JLWadkins, RMTsurkan, LHicks, LDHatfield, MJEdwards, CCRoss, CRCantalupo, SACrundwell, GDanks, MKGuy, RKPotter, PM Planarity and constraint of the carbonyl groups in 1,2-diones are determinants for selective inhibition of human carboxylesterase 1. J Med Chem50:5727-34 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Acyl-CoA: cholesterol acyltransferase (ACAT)
Name:Acyl-CoA: cholesterol acyltransferase (ACAT)
Synonyms:Acyl coenzyme A:cholesterol acyltransferase | Serine hydrolase (CES1)
Type:Protein
Mol. Mass.:62520.83
Organism:Homo sapiens (Human)
Description:n/a
Residue:567
Sequence:
MWLRAFILATLSASAAWGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPL
GPLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQLLSELFTNRKENIPLKLSEDCLYLN
IYTPADLTKKNRLPVMVWIHGGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFST
GDEHSRGNWGHLDQVAALRWVQDNIASFGGNPGSVTIFGESAGGESVSVLVLSPLAKNLF
HRAISESGVALTSVLVKKGDVKPLAEQIAITAGCKTTTSAVMVHCLRQKTEEELLETTLK
MKFLSLDLQGDPRESQPLLGTVIDGMLLLKTPEELQAERNFHTVPYMVGINKQEFGWLIP
MQLMSYPLSEGQLDQKTAMSLLWKSYPLVCIAKELIPEATEKYLGGTDDTVKKKDLFLDL
IADVMFGVPSVIVARNHRDAGAPTYMYEFQYRPSFSSDMKPKTVIGDHGDELFSVFGAPF
LKEGASEEEIRLSKMVMKFWANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLK
DKEVAFWTNLFAKKAVEKPPQTEHIEL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22858
BDBM22723
NameBDBM22858
Synonyms:1,2-Dione-Based Compound, 15 | 2-nitro-9,10-dihydrophenanthrene-9,10-dione | CHEMBL433282 | NSC23180 | US9073941, 904
TypeSmall organic molecule
Emp. Form.C14H7NO4
Mol. Mass.253.2097
SMILES[O-][N+](=O)c1ccc-2c(c1)C(=O)C(=O)c1ccccc-21
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: