Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine deaminase
LigandBDBM22926
Substrate/CompetitorBDBM14487
Meas. Tech.ADA Inhibition Assay
pH7.4±n/a
Temperature295.15±n/a K
Ki 37±n/a nM
Citation Terasaka, TNakanishi, INakamura, KEikyu, YKinoshita, TNishio, NSato, AKuno, MSeki, NSakane, K Structure-based de novo design of non-nucleoside adenosine deaminase inhibitors. Bioorg Med Chem Lett13:1115-8 (2003) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Adenosine deaminase
Name:Adenosine deaminase
Synonyms:Adenosine aminohydrolase
Type:Enzyme
Mol. Mass.:40759.44
Organism:Homo sapiens (Human)
Description:Human recombinant ADA was expressed and purified from an ADA-deficient bacterial strain.
Residue:363
Sequence:
MAQTPAFDKPKVELHVHLDGSIKPETILYYGRRRGIALPANTAEGLLNVIGMDKPLTLPD
FLAKFDYYMPAIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQA
EGDLTPDEVVALVGQGLQEGERDFGVKARSILCCMRHQPNWSPKVVELCKKYQQQTVVAI
DLAGDETIPGSSLLPGHVQAYQEAVKSGIHRTVHAGEVGSAEVVKEAVDILKTERLGHGY
HTLEDQALYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRLKNDQANYSLNTDDPLIF
KSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPEDEKRELLDLLYKAYGMPPSASAG
QNL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM22926
NameBDBM22926
Synonyms:3-(6-amino-9H-purin-9-yl)nonan-2-ol | EHNA | Erythro-9-(2-hydroxy-3-nonyl)adenine
TypeSmall organic molecule
Emp. Form.C14H23N5O
Mol. Mass.277.3653
SMILESCCCCCCC(C(C)O)n1cnc2c(N)ncnc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM14487
NameBDBM14487
Synonyms:(2R,3R,4S,5R)-2-(6-amino-9H-purin-9-yl)-5-(hydroxymethyl)oxolane-3,4-diol | Adenine-beta-D-arabinofuranoside | Adenosine | CHEMBL477 | N6-Methylado | [U-14C]adenosine | cid_191 | cid_60961
TypeNucleoside or nucleotide
Emp. Form.C10H13N5O4
Mol. Mass.267.2413
SMILESNc1ncnc2n(cnc12)[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: