Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetalpha-Amylase
LigandBDBM23413
Substrate/CompetitorBDBM23407
Meas. Tech.In Vitro alpha-Amylase Activity Assay
pH6±n/a
Temperature295.15±n/a K
Comments17.5% inhibition uM.
Citation Lo Piparo, EScheib, HFrei, NWilliamson, GGrigorov, MChou, CJ Flavonoids for controlling starch digestion: structural requirements for inhibiting human alpha-amylase. J Med Chem51:3555-61 (2008) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
alpha-Amylase
Name:alpha-Amylase
Synonyms:1,4-alpha-D-glucan glucanohydrolase 1 | Salivary α-amylase | Salivary alpha-amylase | alpha-amylase 1
Type:Glycosidase
Mol. Mass.:57770.18
Organism:Homo sapiens (Human)
Description:Purchased from Sigma Chemical Co.
Residue:511
Sequence:
MKLFWLLFTIGFCWAQYSSNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPP
NENVAIHNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGN
AVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLSGL
LDLALGKDYVRSKIAEYMNHLIDIGVAGFRIDASKHMWPGDIKAILDKLHNLNSNWFPEG
SKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWG
FMPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWP
RYFENGKDVNDWVGPPNDNGVTKEVTINPDTTCGNDWVCEHRWRQIRNMVNFRNVVDGQP
FTNWYDNGSNQVAFGRGNRGFIVFNNDDWTFSLTLQTGLPAGTYCDVISGDKINGNCTGI
KIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM23413
NameBDBM23413
Synonyms:5-hydroxy-7-methoxy-2-(4-methoxyphenyl)-4H-chromen-4-one | Apigenin-7,4'-dimethylether | Genkwanin | apigenin dimethylether
Typeflavone
Emp. Form.C17H14O5
Mol. Mass.298.2901
SMILESCOc1ccc(cc1)-c1cc(=O)c2c(O)cc(OC)cc2o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM23407
NameBDBM23407
Synonyms:(2R,3S,4S,5R,6R)-2-(hydroxymethyl)-6-{[(2R,3S,4R,5R,6S)-4,5,6-trihydroxy-2-(hydroxymethyl)oxan-3-yl]oxy}oxane-3,4,5-triol | Potato starch
Typen/a
Emp. Form.C12H22O11
Mol. Mass.342.2965
SMILESOC[C@H]1O[C@H](O[C@H]2[C@H](O)[C@@H](O)[C@@H](O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@@H]1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: