Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThrombin
LigandBDBM23877
Substrate/CompetitorBDBM23924
Meas. Tech.Determination of Inhibition Constants
Ki 460±n/a nM
Citation Steinmetzer, TSchweinitz, AStürzebecher, ADönnecke, DUhland, KSchuster, OSteinmetzer, PMüller, FFriedrich, RThan, MEBode, WStürzebecher, J Secondary amides of sulfonylated 3-amidinophenylalanine. New potent and selective inhibitors of matriptase. J Med Chem49:4116-26 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Thrombin
Name:Thrombin
Synonyms:Activation peptide fragment 1 | Activation peptide fragment 2 | Coagulation factor II | Prothrombin | Thrombin heavy chain | Thrombin light chain
Type:Enzyme
Mol. Mass.:70502.73
Organism:Bos taurus (Bovine)
Description:P00735
Residue:625
Sequence:
MARVRGPRLPGCLALAALFSLVHSQHVFLAHQQASSLLQRARRANKGFLEEVRKGNLERE
CLEEPCSREEAFEALESLSATDAFWAKYTACESARNPREKLNECLEGNCAEGVGMNYRGN
VSVTRSGIECQLWRSRYPHKPEINSTTHPGADLRENFCRNPDGSITGPWCYTTSPTLRRE
ECSVPVCGQDRVTVEVIPRSGGSTTSQSPLLETCVPDRGREYRGRLAVTTSGSRCLAWSS
EQAKALSKDQDFNPAVPLAENFCRNPDGDEEGAWCYVADQPGDFEYCDLNYCEEPVDGDL
GDRLGEDPDPDAAIEGRTSEDHFQPFFNEKTFGAGEADCGLRPLFEKKQVQDQTEKELFE
SYIEGRIVEGQDAEVGLSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNF
TVDDLLVRIGKHSRTRYERKVEKISMLDKIYIHPRYNWKENLDRDIALLKLKRPIELSDY
IHPVCLPDKQTAAKLLHAGFKGRVTGWGNRRETWTTSVAEVQPSVLQVVNLPLVERPVCK
ASTRIRITDNMFCAGYKPGEGKRGDACEGDSGGPFVMKSPYNNRWYQMGIVSWGEGCDRD
GKYGFYTHVFRLKKWIQKVIDRLGS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM23877
NameBDBM23877
Synonyms:3-[(2S)-2-(anthracene-2-sulfonamido)-3-[4-(3-carbamimidamidopropanoyl)piperazin-1-yl]-3-oxopropyl]benzene-1-carboximidamide | 3-amidinophenylalanine deriv., 21
TypeSmall organic molecule
Emp. Form.C32H36N8O4S
Mol. Mass.628.744
SMILES[#7]\[#6](-[#7])=[#7]/[#6]-[#6]-[#6](=O)-[#7]-1-[#6]-[#6]-[#7](-[#6]-[#6]-1)-[#6](=O)-[#6@H](-[#6]-c1cccc(c1)-[#6](-[#7])=[#7])-[#7]S(=O)(=O)c1ccc2cc3ccccc3cc2c1 |r|
Structure
BDBM23924
NameBDBM23924
Synonyms:MeSO2-D-hexahydrotyrosyl-Gly-Arg-p-nitroanilide | MeSO2-D-hexahydrotyrosyl-Gly-Arg-pNA
Typen/a
Emp. Form.n/a
Mol. Mass.n/a
SMILESn/a
Structure