Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBacterial leucyl aminopeptidase
LigandBDBM23989
Substrate/CompetitorBDBM23972
Meas. Tech.Enzyme Inhibition Assay
IC50>1000000±n/a nM
Citation Albrecht, SDefoin, ASalomon, ETarnus, CWetterholm, AHaeggström, JZ Synthesis and structure activity relationships of novel non-peptidic metallo-aminopeptidase inhibitors. Bioorg Med Chem14:7241-57 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Bacterial leucyl aminopeptidase
Name:Bacterial leucyl aminopeptidase
Synonyms:Bacterial leucyl aminopeptidase precursor
Type:PROTEIN
Mol. Mass.:54213.72
Organism:Vibrio proteolyticus
Description:ChEMBL_1507540
Residue:504
Sequence:
MKYTKTLLAMVLSATFCQAYAEDKVWISIGADANQTVMKSGAESILPNSVASSGQVWVGQ
VDVAQLAELSHNMHEEHNRCGGYMVHPSAQSAMAASAMPTTLASFVMPPITQQATVTAWL
PQVDASQITGTISSLESFTNRFYTTTSGAQASDWIASEWQALSASLPNASVKQVSHSGYN
QKSVVMTITGSEAPDEWIVIGGHLDSTIGSHTNEQSVAPGADDDASGIAAVTEVIRVLSE
NNFQPKRSIAFMAYAAEEVGLRGSQDLANQYKSEGKNVVSALQLDMTNYKGSAQDVVFIT
DYTDSNFTQYLTQLMDEYLPSLTYGFDTCGYACSDHASWHNAGYPAAMPFESKFNDYNPR
IHTTQDTLANSDPTGSHAKKFTQLGLAYAIEMGSATGDTPTPGNQLEDGVPVTDLSGSRG
SNVWYTFELETQKNLQITTSGGYGDLDLYVKFGSKASKQNWDCRPYLSGNNEVCTFNNAS
PGTYSVMLTGYSNYSGASLKASTF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM23989
NameBDBM23989
Synonyms:1,2,3,4-tetrahydronaphthalen-2-one | CHEMBL191664 | dihydro-naphthalenone, 4e | dihydronaphthalenone
TypeSmall organic molecule
Emp. Form.C10H10O
Mol. Mass.146.1858
SMILESO=C1CCc2ccccc2C1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
BDBM23972
NameBDBM23972
Synonyms:(2S)-2-amino-4-methyl-N-(4-nitrophenyl)pentanamide | L-Leucine-p-nitroanilide | L-Leucine-para-nitroanilide
Typen/a
Emp. Form.C12H17N3O3
Mol. Mass.251.2817
SMILESCC(C)C[C@H](N)C(=O)Nc1ccc(cc1)[N+]([O-])=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: